BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0147 (621 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 25 0.39 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 24 1.2 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 21 6.3 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 8.3 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 25.4 bits (53), Expect = 0.39 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +3 Query: 369 TFSKLLPSYDGSSRTLVFYIDSENVDNALN 458 TF++L S +G + Y+ ENV+ LN Sbjct: 740 TFTELSKSLEGLLENVAQYLQIENVEQTLN 769 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 23.8 bits (49), Expect = 1.2 Identities = 9/37 (24%), Positives = 17/37 (45%) Frame = -2 Query: 617 HFRVLVYRFFYTMLLLYLSRFLHLGFVTKRQQLYHLI 507 HF + Y F+Y ++L + + F+ L L+ Sbjct: 95 HFLLCTYYFYYAFIILLCVYYFYYAFIIFTVHLLFLL 131 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 21.4 bits (43), Expect = 6.3 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -3 Query: 307 FLSQLLYFINSVYK*RIKELGRMV 236 F LLY I + R KEL R++ Sbjct: 162 FYQLLLYLITDMILMRYKELNRVI 185 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 8.3 Identities = 8/26 (30%), Positives = 13/26 (50%) Frame = -1 Query: 621 LPFSGSSLPIFLYNASFISIPVFAPG 544 +PF G S + N + + P+ PG Sbjct: 417 VPFFGRSFTLQFTNETQVGAPIKGPG 442 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 124,805 Number of Sequences: 336 Number of extensions: 2182 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15875032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -