BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0144 (620 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory recept... 24 1.2 EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 22 4.8 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 22 4.8 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 8.3 AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 21 8.3 >AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory receptor candidate 50 protein. Length = 350 Score = 23.8 bits (49), Expect = 1.2 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 493 YKYKQLAYMLLYYY*VCSNNLYYCNSTYFFKFSLTDKRF 377 Y ++ ++L + +C YYC + F +LTD F Sbjct: 232 YGFQNFLFVLSTFS-ICITQFYYCYDSGFNSDNLTDVYF 269 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 21.8 bits (44), Expect = 4.8 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -2 Query: 163 VKVNSNCE*WI*KRQRATEVPIYE 92 V+VNS E W+ R+ VP E Sbjct: 127 VEVNSRPETWVLGREMCKAVPFVE 150 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 21.8 bits (44), Expect = 4.8 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -2 Query: 163 VKVNSNCE*WI*KRQRATEVPIYE 92 V+VNS E W+ R+ VP E Sbjct: 127 VEVNSRPETWVLGREMCKAVPFVE 150 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 8.3 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = +3 Query: 471 YASCLYLYYRVHYSLNLLTDTRFVPGNTVV 560 Y +Y Y+ ++SLN + PG V+ Sbjct: 2532 YPGDVYDYFNANFSLNYWIEKGADPGKIVM 2561 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 21.0 bits (42), Expect = 8.3 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +2 Query: 479 LFILVLSCSLFLKFIN*YQV 538 L++L+L C++ L F YQ+ Sbjct: 178 LWVLILICNIALAFKQRYQL 197 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,513 Number of Sequences: 336 Number of extensions: 2490 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15875032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -