SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0144
         (620 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g47800.1 68418.m05904 phototropic-responsive NPH3 family prot...    27   7.6  

>At5g47800.1 68418.m05904 phototropic-responsive NPH3 family protein
           contains NPH3 family domain, Pfam:PF03000
          Length = 559

 Score = 27.5 bits (58), Expect = 7.6
 Identities = 10/33 (30%), Positives = 19/33 (57%)
 Frame = -1

Query: 305 CSRTNSVIRKHLIRNEPQSISSQMTELFMDCES 207
           C + ++ +R H ++NE   + + +  LF D ES
Sbjct: 444 CQKLSAQVRAHAVKNERMPLRTVVQALFFDQES 476


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,795,215
Number of Sequences: 28952
Number of extensions: 182634
Number of successful extensions: 299
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 296
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 299
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1255974912
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -