BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0143 (618 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6561| Best HMM Match : HEAT (HMM E-Value=0.028) 30 1.7 SB_37484| Best HMM Match : DUF746 (HMM E-Value=4.1) 29 4.0 SB_13410| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 >SB_6561| Best HMM Match : HEAT (HMM E-Value=0.028) Length = 1444 Score = 29.9 bits (64), Expect = 1.7 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 3/66 (4%) Frame = -2 Query: 299 KCIQHLLSNLN-KGFI*RKARNYFNSIKHSILNEL*NCKTRLYTYVFHTNLDIITVNI-- 129 KCI +L + K F+ + FNS+KHS E C L + TNLDI + + Sbjct: 499 KCIGIVLRKVTQKDFLQIQLNEMFNSVKHSCQIEREGCAIGL-GFCAGTNLDIALIKLEQ 557 Query: 128 IEKSNM 111 I K++M Sbjct: 558 ITKTDM 563 >SB_37484| Best HMM Match : DUF746 (HMM E-Value=4.1) Length = 465 Score = 28.7 bits (61), Expect = 4.0 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +1 Query: 166 TYVYNRVLQFHSSFNIECF 222 T+V NRV + HSSF+ EC+ Sbjct: 289 TFVANRVAEIHSSFDPECW 307 >SB_13410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1984 Score = 27.9 bits (59), Expect = 7.0 Identities = 9/26 (34%), Positives = 18/26 (69%) Frame = +1 Query: 100 SHQCILLFSIILTVIISKLV*NTYVY 177 SH C+++ ++L V ++ ++ N YVY Sbjct: 1777 SHACVVVLMLLLMVTLASVLVNAYVY 1802 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,338,072 Number of Sequences: 59808 Number of extensions: 262811 Number of successful extensions: 387 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 347 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 386 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1524174750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -