BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0143 (618 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81524-6|CAB04254.2| 308|Caenorhabditis elegans Hypothetical pr... 28 6.1 Z81103-8|CAB03212.2| 308|Caenorhabditis elegans Hypothetical pr... 28 6.1 >Z81524-6|CAB04254.2| 308|Caenorhabditis elegans Hypothetical protein F32H5.6a protein. Length = 308 Score = 27.9 bits (59), Expect = 6.1 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = -1 Query: 618 ICMYVKSVLSGTIVSIKLCNCNEGYALVSTA-IAFIFIS 505 I MY++SVL T+ I + NC + L S FIF+S Sbjct: 217 ISMYIQSVLQDTLHLIDMINCTILFKLNSAIWYQFIFLS 255 >Z81103-8|CAB03212.2| 308|Caenorhabditis elegans Hypothetical protein F32H5.6a protein. Length = 308 Score = 27.9 bits (59), Expect = 6.1 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = -1 Query: 618 ICMYVKSVLSGTIVSIKLCNCNEGYALVSTA-IAFIFIS 505 I MY++SVL T+ I + NC + L S FIF+S Sbjct: 217 ISMYIQSVLQDTLHLIDMINCTILFKLNSAIWYQFIFLS 255 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,040,846 Number of Sequences: 27780 Number of extensions: 220475 Number of successful extensions: 474 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 433 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 474 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1342816466 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -