BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0140 (665 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 23 3.0 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 21 6.9 AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 prot... 21 6.9 AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 21 6.9 AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 21 9.1 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 22.6 bits (46), Expect = 3.0 Identities = 11/48 (22%), Positives = 20/48 (41%) Frame = +2 Query: 479 QRSASNVPRPSPSRCLRQSAAGPTEPKNRLSRSLQAACKALSCTRGFG 622 ++S P PS + + T SRS+ +C ++ T +G Sbjct: 68 KKSPQGAPSPSSTPSSLPTQRTSTSNPTYSSRSVMTSCSSVPTTASYG 115 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 21.4 bits (43), Expect = 6.9 Identities = 9/37 (24%), Positives = 17/37 (45%) Frame = -1 Query: 578 SSSTNDSSVPLVPLPTDEDNGSERVEEHWMRFFAQPT 468 +++ +P P+PT E ++ E + QPT Sbjct: 383 NAALKSDEIPPEPVPTPEPQPTQTTESEPTQASEQPT 419 >AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 protein. Length = 377 Score = 21.4 bits (43), Expect = 6.9 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -1 Query: 458 SYIYLGNYPNYTL 420 +Y +LG YPN TL Sbjct: 57 NYAFLGVYPNGTL 69 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 21.4 bits (43), Expect = 6.9 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = -3 Query: 624 PPKPRVHESALQAACKL 574 PP+ +++++ AACKL Sbjct: 62 PPQDSPYDASVAAACKL 78 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 21.0 bits (42), Expect = 9.1 Identities = 14/39 (35%), Positives = 16/39 (41%) Frame = +2 Query: 41 TSTT*MRHTP*DIVLRSQYSHNGCPTLQTETHYCFTAEI 157 TS H DIV Q HN L E + CF +I Sbjct: 196 TSLIHSTHLNGDIVKEHQNLHNKICNLIDEFNECFGLQI 234 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,395 Number of Sequences: 336 Number of extensions: 3144 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17281430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -