BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0136 (728 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0136 - 15122420-15122469,15123845-15124334,15124822-151249... 32 0.54 >10_08_0136 - 15122420-15122469,15123845-15124334,15124822-15124935, 15125022-15125303,15125422-15125591,15125670-15125757, 15126128-15126173,15126254-15126336,15126595-15126694, 15127002-15127081,15127200-15127283,15127373-15127531, 15128617-15128772,15129634-15130197 Length = 821 Score = 31.9 bits (69), Expect = 0.54 Identities = 21/68 (30%), Positives = 33/68 (48%) Frame = +2 Query: 305 ITTRPKTEKPVQKTRTKLTSKPLSVSVIYDYPETVYNTKPPASSEKPFIVYVPQKNPNVI 484 + TR K+ P K + K+ P+ V D+PE+ KPPA + PF K+ V+ Sbjct: 174 MATRDKSAAPGAKAKEKI---PMEQLVDRDFPESE-PIKPPALDDTPFTHVEDLKSLEVL 229 Query: 485 ANDISSTS 508 A + S + Sbjct: 230 ATKLKSAT 237 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,710,459 Number of Sequences: 37544 Number of extensions: 301113 Number of successful extensions: 657 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 641 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 657 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1909952136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -