BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0135 (583 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC9G1.10c |||inositol polyphosphate phosphatase |Schizosacchar... 26 3.5 SPBC13E7.07 |||sequence orphan|Schizosaccharomyces pombe|chr 2||... 25 6.1 SPAC27E2.09 |mak2|phk1|histidine kinase Mak2 |Schizosaccharomyce... 25 6.1 SPAC20H4.10 |ufd2||ubiquitin-protein ligase E4 |Schizosaccharomy... 25 6.1 >SPAC9G1.10c |||inositol polyphosphate phosphatase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1191 Score = 26.2 bits (55), Expect = 3.5 Identities = 13/37 (35%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Frame = +1 Query: 127 LHWPFDCRVGHRCPTRRTEVIMSI---SVTKAPPLPS 228 LH PF G CP +++I S+ PP+PS Sbjct: 238 LHDPFSQTFGKECPISTAPPVLNIGDRSLETPPPIPS 274 >SPBC13E7.07 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 273 Score = 25.4 bits (53), Expect = 6.1 Identities = 8/27 (29%), Positives = 16/27 (59%) Frame = -2 Query: 573 FKWVICMTPKYVRYFYIGSNNSSLSKK 493 F+W + YV Y+++ S++ L+ K Sbjct: 8 FRWAFLIATVYVAYYFLVSSDKKLATK 34 >SPAC27E2.09 |mak2|phk1|histidine kinase Mak2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 2310 Score = 25.4 bits (53), Expect = 6.1 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = -2 Query: 189 NYFSAPRRAPVTYTTVKGPMQFFSCIICEVFLTSK 85 NYF +R P + + G + F C++ + TS+ Sbjct: 488 NYFKLKKRDPQQFRSASGRLGFMVCLLEILSFTSR 522 >SPAC20H4.10 |ufd2||ubiquitin-protein ligase E4 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1010 Score = 25.4 bits (53), Expect = 6.1 Identities = 12/25 (48%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = -1 Query: 142 QRANAIFLMHNMRSFFDFE-IMNFV 71 +RA +I HN++S FD E I FV Sbjct: 887 ERATSIMTKHNLKSSFDIEAIKEFV 911 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,301,800 Number of Sequences: 5004 Number of extensions: 44052 Number of successful extensions: 98 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 97 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 98 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 250133048 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -