BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0135 (583 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB038044-1|BAB62394.1| 852|Caenorhabditis elegans N-deacetylase... 29 2.4 Z73102-13|CAA97405.1| 836|Caenorhabditis elegans Hypothetical p... 27 9.7 >AB038044-1|BAB62394.1| 852|Caenorhabditis elegans N-deacetylase/N-sulfotransferase protein. Length = 852 Score = 29.1 bits (62), Expect = 2.4 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = -2 Query: 570 KWVICMTPKYVRYFYIGSNNSSLSKKFELFILVSNYYC 457 KW++ + Y+ Y + SNNS K + LV NY C Sbjct: 16 KWILALIFLYLIYICLFSNNSKPPKPRKKPKLVENYTC 53 >Z73102-13|CAA97405.1| 836|Caenorhabditis elegans Hypothetical protein B0035.12 protein. Length = 836 Score = 27.1 bits (57), Expect = 9.7 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -3 Query: 248 NIH*QTIEGNGGALVTEIDIITSVRRVGHR 159 N+H Q + AL ++ +TSVRRV H+ Sbjct: 689 NVHFQATDDELKALFSKFGTVTSVRRVTHK 718 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,424,993 Number of Sequences: 27780 Number of extensions: 237807 Number of successful extensions: 448 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 445 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 448 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1215936170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -