BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0134 (707 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC12C2.08 |dnm1||dynamin Dnm1|Schizosaccharomyces pombe|chr 2|... 27 2.6 SPBC31F10.13c |hip1|hir1|hira protein Hip1|Schizosaccharomyces p... 26 4.6 >SPBC12C2.08 |dnm1||dynamin Dnm1|Schizosaccharomyces pombe|chr 2|||Manual Length = 781 Score = 27.1 bits (57), Expect = 2.6 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +3 Query: 588 QLSIRAAPAHRCAELLVRE 644 QL++ AAP H+C EL+ E Sbjct: 450 QLNLLAAPCHQCVELVYEE 468 >SPBC31F10.13c |hip1|hir1|hira protein Hip1|Schizosaccharomyces pombe|chr 2|||Manual Length = 932 Score = 26.2 bits (55), Expect = 4.6 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -1 Query: 308 GTPGWQSAALYVTIAYTEQYHCLLREHRHGNILM 207 G+ W S+ L + TE + EHR N+LM Sbjct: 777 GSREWDSSGLLQSNTQTESQPLKIYEHRTNNVLM 810 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,829,745 Number of Sequences: 5004 Number of extensions: 57663 Number of successful extensions: 158 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 153 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 158 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 329179816 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -