BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0134 (707 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 24 1.6 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 24 1.6 S76956-1|AAB33931.1| 168|Apis mellifera olfactory receptor prot... 23 3.7 S76957-1|AAB33932.1| 169|Apis mellifera olfactory receptor prot... 22 5.0 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 22 5.0 U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive o... 21 8.7 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 21 8.7 AM158085-1|CAJ43389.1| 171|Apis mellifera globin 1 protein. 21 8.7 AM158084-1|CAJ43388.1| 171|Apis mellifera globin 1 protein. 21 8.7 AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 21 8.7 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 21 8.7 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 8.7 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 21 8.7 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 23.8 bits (49), Expect = 1.6 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +2 Query: 200 IPTLEYFHGGALEEGSG 250 +P + + HGGA + GSG Sbjct: 122 LPVIFWIHGGAFQFGSG 138 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 23.8 bits (49), Expect = 1.6 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +2 Query: 200 IPTLEYFHGGALEEGSG 250 +P + + HGGA + GSG Sbjct: 122 LPVIFWIHGGAFQFGSG 138 >S76956-1|AAB33931.1| 168|Apis mellifera olfactory receptor protein. Length = 168 Score = 22.6 bits (46), Expect = 3.7 Identities = 10/34 (29%), Positives = 22/34 (64%) Frame = +1 Query: 25 YAKVFIDLSHFRILYKNIKLSRNGG*RTGNSCTS 126 ++ + I +S+ IL +++S +GG R ++C+S Sbjct: 88 FSVLTILISYIYILMAILRMSADGGCRNFSTCSS 121 >S76957-1|AAB33932.1| 169|Apis mellifera olfactory receptor protein. Length = 169 Score = 22.2 bits (45), Expect = 5.0 Identities = 9/27 (33%), Positives = 18/27 (66%) Frame = +1 Query: 46 LSHFRILYKNIKLSRNGG*RTGNSCTS 126 +S+ IL +++S +GG R ++C+S Sbjct: 96 ISYIYILMAILRMSADGGCRNFSTCSS 122 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 22.2 bits (45), Expect = 5.0 Identities = 10/19 (52%), Positives = 12/19 (63%), Gaps = 1/19 (5%) Frame = +1 Query: 253 CSVY-AIVTYKAADCHPGV 306 C++ AI T ADC PGV Sbjct: 638 CNIMDAICTKLTADCQPGV 656 >U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive opsin protein. Length = 377 Score = 21.4 bits (43), Expect = 8.7 Identities = 13/54 (24%), Positives = 21/54 (38%) Frame = -3 Query: 306 YSRVAVCSLVCNYCIYRAVPLPSSRAPPWKYSNVGIR*FTFSSFMKAPLTAVAS 145 YS + + SLV N C+ S P V + F + P+ ++S Sbjct: 64 YSMLLIMSLVGNCCVIWIFSTSKSLRTPSNMFIVSLAIFDIIMAFEMPMLVISS 117 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 21.4 bits (43), Expect = 8.7 Identities = 7/10 (70%), Positives = 10/10 (100%) Frame = -2 Query: 364 YQQLQLHSED 335 Y+QL+LH+ED Sbjct: 332 YKQLELHTED 341 >AM158085-1|CAJ43389.1| 171|Apis mellifera globin 1 protein. Length = 171 Score = 21.4 bits (43), Expect = 8.7 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = -3 Query: 186 FSSFMKAPLTAVASITNTISACTGVSGALATI 91 F++FM PL + + + C GV AL + Sbjct: 65 FTAFMDTPLNELPANKRFQAHCAGVITALNNV 96 >AM158084-1|CAJ43388.1| 171|Apis mellifera globin 1 protein. Length = 171 Score = 21.4 bits (43), Expect = 8.7 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = -3 Query: 186 FSSFMKAPLTAVASITNTISACTGVSGALATI 91 F++FM PL + + + C GV AL + Sbjct: 65 FTAFMDTPLNELPANKRFQAHCAGVITALNNV 96 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +2 Query: 191 NYLIPTLEYFHGGALEEGSGT 253 N L+P L + +GG G+ T Sbjct: 155 NGLLPLLVWIYGGGFMSGTAT 175 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 21.4 bits (43), Expect = 8.7 Identities = 13/54 (24%), Positives = 21/54 (38%) Frame = -3 Query: 306 YSRVAVCSLVCNYCIYRAVPLPSSRAPPWKYSNVGIR*FTFSSFMKAPLTAVAS 145 YS + + SLV N C+ S P V + F + P+ ++S Sbjct: 64 YSMLLIMSLVGNCCVIWIFSTSKSLRTPSNMFIVSLAIFDIIMAFEMPMLVISS 117 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.4 bits (43), Expect = 8.7 Identities = 13/39 (33%), Positives = 17/39 (43%) Frame = -2 Query: 649 GGSRTRSSAQRCAGAARIDS*TPRSLSILAACSIVAGTP 533 G S S A A S +PR S AA +++G P Sbjct: 820 GNSPASSPRYLSAAATSSTSTSPRPASSTAATLVLSGCP 858 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +2 Query: 191 NYLIPTLEYFHGGALEEGSGT 253 N L+P L + +GG G+ T Sbjct: 155 NGLLPLLVWIYGGGFMSGTAT 175 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 194,993 Number of Sequences: 438 Number of extensions: 4606 Number of successful extensions: 18 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21804885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -