BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0134 (707 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g24590.2 68418.m02905 turnip crinkle virus-interacting protei... 28 7.0 At4g26290.1 68417.m03782 expressed protein 27 9.2 >At5g24590.2 68418.m02905 turnip crinkle virus-interacting protein / TCV-interacting protein (TIP) contains Pfam PF02365: No apical meristem (NAM) domain; similar to NAC2 (GI:6456751) {Arabidopsis thaliana}; identical to cDNA TIP mRNA, GI:9408600 Length = 451 Score = 27.9 bits (59), Expect = 7.0 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +3 Query: 573 SERGVQLSIRAAPAHRCAELLVREPPAGERLQ 668 S+RG+++ R A A CAE V + A RL+ Sbjct: 338 SKRGIKIRARRAQAPGCAEQFVMQGDASRRLR 369 >At4g26290.1 68417.m03782 expressed protein Length = 75 Score = 27.5 bits (58), Expect = 9.2 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +2 Query: 98 ANAPETPVQAEIVFVIEATAVNGAFINELKVNYL 199 A PETP+ FV+E + FI+ VNY+ Sbjct: 42 AEDPETPITPSSSFVVEIRLPSRMFISSSFVNYV 75 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,035,740 Number of Sequences: 28952 Number of extensions: 314124 Number of successful extensions: 816 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 784 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 816 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1526202912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -