BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0132 (544 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC047683-1|AAH47683.1| 543|Homo sapiens DALR anticodon binding ... 30 6.0 BC032440-1|AAH32440.2| 543|Homo sapiens DALR anticodon binding ... 30 6.0 AK093294-1|BAC04123.1| 376|Homo sapiens protein ( Homo sapiens ... 30 6.0 AK093204-1|BAC04095.1| 376|Homo sapiens protein ( Homo sapiens ... 30 6.0 >BC047683-1|AAH47683.1| 543|Homo sapiens DALR anticodon binding domain containing 3 protein. Length = 543 Score = 29.9 bits (64), Expect = 6.0 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -1 Query: 325 RSAIYDCLSPAIHISVRAVTSCHHICNRSI 236 R+A+ DC +P +HI+VR C + S+ Sbjct: 462 RTAVLDCTAPGLHIAVRTEMICKFLVQLSM 491 >BC032440-1|AAH32440.2| 543|Homo sapiens DALR anticodon binding domain containing 3 protein. Length = 543 Score = 29.9 bits (64), Expect = 6.0 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -1 Query: 325 RSAIYDCLSPAIHISVRAVTSCHHICNRSI 236 R+A+ DC +P +HI+VR C + S+ Sbjct: 462 RTAVLDCTAPGLHIAVRTEMICKFLVQLSM 491 >AK093294-1|BAC04123.1| 376|Homo sapiens protein ( Homo sapiens cDNA FLJ35975 fis, clone TESTI2013401. ). Length = 376 Score = 29.9 bits (64), Expect = 6.0 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -1 Query: 325 RSAIYDCLSPAIHISVRAVTSCHHICNRSI 236 R+A+ DC +P +HI+VR C + S+ Sbjct: 295 RTAVLDCTAPGLHIAVRTEMICKFLVQLSM 324 >AK093204-1|BAC04095.1| 376|Homo sapiens protein ( Homo sapiens cDNA FLJ35885 fis, clone TESTI2009018. ). Length = 376 Score = 29.9 bits (64), Expect = 6.0 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -1 Query: 325 RSAIYDCLSPAIHISVRAVTSCHHICNRSI 236 R+A+ DC +P +HI+VR C + S+ Sbjct: 295 RTAVLDCTAPGLHIAVRTEMICKFLVQLSM 324 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 84,851,939 Number of Sequences: 237096 Number of extensions: 1808024 Number of successful extensions: 11403 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 11349 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11403 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5308067764 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -