BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0130 (669 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0749 + 21212463-21212911,21212976-21213305,21213336-212134... 29 3.3 >07_03_0749 + 21212463-21212911,21212976-21213305,21213336-21213436, 21213758-21213883,21213962-21214083,21214177-21214450, 21214767-21215004,21215101-21215248,21215400-21215732 Length = 706 Score = 29.1 bits (62), Expect = 3.3 Identities = 29/111 (26%), Positives = 48/111 (43%), Gaps = 8/111 (7%) Frame = -3 Query: 352 IISRRRLSGTITLEKGKQDRCFD---KRHLHTGSINSRYTK*IYT---TTPDFVLDGNL* 191 II R S I L + + + D R L G ++R T+ + T P++ +DGN+ Sbjct: 502 IIHRDLKSNNILLGEDMEPKIADFGLARLLGEGHTHTRTTRVVGTFGYMAPEYAIDGNVS 561 Query: 190 LS*IIFSLRAIKCVQIFNVPNVNFDISDKISIFCD--NTWPR*PVFVINDE 44 IFS + + N N D D +++ D N W + V + D+ Sbjct: 562 TKIDIFSFGVLVLEIVTRRRNCNSDDHDLVNLLSDVWNCWTKGTVSQMIDQ 612 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,361,316 Number of Sequences: 37544 Number of extensions: 308202 Number of successful extensions: 476 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 466 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 476 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1691314196 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -