BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0129 (553 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0393 - 24894170-24894676,24895956-24896627,24897720-248979... 27 7.5 04_03_1045 - 21972877-21972945,21973191-21973559,21973699-21974136 27 10.0 >04_04_0393 - 24894170-24894676,24895956-24896627,24897720-24897956, 24898852-24899388,24899612-24899662,24900756-24900767 Length = 671 Score = 27.5 bits (58), Expect = 7.5 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -2 Query: 411 TCSARSRGTGTSCTLDTPSPETAPGSCK*VDATPSY 304 TCSAR++ G TL T P + G+ + DA SY Sbjct: 520 TCSARAKEEGGIDTLGTNDPLSVAGNGRCFDAHISY 555 >04_03_1045 - 21972877-21972945,21973191-21973559,21973699-21974136 Length = 291 Score = 27.1 bits (57), Expect = 10.0 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +3 Query: 351 PAKVYPACTRCLCLVNELSRFRMHCISVFICGWIR 455 PA V RC C +ELS + +++ C W+R Sbjct: 158 PALVDMELDRCKCFFHELSSATLRSLAMESCLWMR 192 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,606,515 Number of Sequences: 37544 Number of extensions: 330277 Number of successful extensions: 805 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 793 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 805 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1245816180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -