BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0129 (553 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 5.0 AY330181-1|AAQ16287.1| 156|Anopheles gambiae odorant-binding pr... 23 5.0 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 23 5.0 DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. 23 6.7 AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-b... 23 8.8 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.4 bits (48), Expect = 5.0 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = -2 Query: 390 GTGTSCTLDTPSPETAPGSCK*VDATPSYVNAGIRTRTSDT 268 G+GT C+ T P A S ++TPS A I T +D+ Sbjct: 1300 GSGTECSASTSEPAPAAPS----NSTPSRSVARIVTSFTDS 1336 >AY330181-1|AAQ16287.1| 156|Anopheles gambiae odorant-binding protein AgamOBP55 protein. Length = 156 Score = 23.4 bits (48), Expect = 5.0 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = +3 Query: 321 QLTCMIQEPFPAKVYPAC 374 Q+ CM++ FP + Y C Sbjct: 28 QVCCMVEHTFPQEPYRVC 45 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 23.4 bits (48), Expect = 5.0 Identities = 12/22 (54%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +1 Query: 7 TNPGGKLLTGGRTS-CESARVG 69 TN GG+L TGG T+ C A G Sbjct: 181 TNGGGELTTGGGTNGCTKAGGG 202 >DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. Length = 847 Score = 23.0 bits (47), Expect = 6.7 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = -3 Query: 113 VLGSCFTAVIDRAVVPTRADSQEVLPPVNSFPPGFV 6 ++ CF + A+VPT ++ + P +FP G V Sbjct: 622 MIDGCFEEG-ENAIVPTPPTTRRPIAPPKNFPRGKV 656 >AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-binding protein OBPjj17 protein. Length = 285 Score = 22.6 bits (46), Expect = 8.8 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -2 Query: 93 GSYRQGGGTYPCGLTR 46 G Y Q GG YP G R Sbjct: 253 GQYDQRGGNYPRGTER 268 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 591,467 Number of Sequences: 2352 Number of extensions: 11812 Number of successful extensions: 22 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 51301854 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -