BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0129 (553 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 26 0.29 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 22 4.8 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 22 4.8 D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 21 8.3 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 21 8.3 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 25.8 bits (54), Expect = 0.29 Identities = 13/35 (37%), Positives = 23/35 (65%), Gaps = 3/35 (8%) Frame = +2 Query: 209 LSKKKNPQLYTESIHTWLTV---VSDVRVRIPALT 304 ++K+ N ++YT S+++ LTV V+ V + IP T Sbjct: 522 VNKRNNAKIYTSSVNSNLTVNQTVNPVAINIPGDT 556 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.8 bits (44), Expect = 4.8 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = -2 Query: 381 TSCTLDTPSPETAPGSCK 328 T CT+ P+ G+CK Sbjct: 230 TGCTITRVIPQVCSGNCK 247 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.8 bits (44), Expect = 4.8 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = -2 Query: 381 TSCTLDTPSPETAPGSCK 328 T CT+ P+ G+CK Sbjct: 230 TGCTITRVIPQVCSGNCK 247 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.0 bits (42), Expect = 8.3 Identities = 7/29 (24%), Positives = 17/29 (58%) Frame = -1 Query: 445 PQMNTLMQCMRNLLSSFTRHRHLVHAGYT 359 P+ +++ R++L F + +H++ YT Sbjct: 261 PETYNVVRKFRDVLDEFPQPKHMLIEAYT 289 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.0 bits (42), Expect = 8.3 Identities = 7/29 (24%), Positives = 17/29 (58%) Frame = -1 Query: 445 PQMNTLMQCMRNLLSSFTRHRHLVHAGYT 359 P+ +++ R++L F + +H++ YT Sbjct: 261 PETYNVVRKFRDVLDEFPQPKHMLIEAYT 289 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,278 Number of Sequences: 438 Number of extensions: 3605 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15827139 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -