BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0128 (731 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 23 1.9 DQ855496-1|ABH88183.1| 129|Tribolium castaneum chemosensory pro... 22 4.4 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 7.8 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 23.4 bits (48), Expect = 1.9 Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = -3 Query: 468 DLVSRK--NVEYLVVEAAGETRELRLDKITSFSH 373 DL+ +K N++ LV + E ++ LD I F H Sbjct: 453 DLIEQKVKNIQMLVYQNEAEEVKILLDVINHFPH 486 >DQ855496-1|ABH88183.1| 129|Tribolium castaneum chemosensory protein 10 protein. Length = 129 Score = 22.2 bits (45), Expect = 4.4 Identities = 7/13 (53%), Positives = 12/13 (92%) Frame = -2 Query: 40 RRLLHYLINNIRE 2 R+++HYLI+N R+ Sbjct: 87 RKIIHYLIDNKRD 99 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.4 bits (43), Expect = 7.8 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +2 Query: 158 AAISPKTDANLKPCPLRPVMSSVLSWPGEG 247 A++SP ++ P + PV + + S PG+G Sbjct: 175 ASVSPLISSSSSPPGVFPVDAPMHSPPGDG 204 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,341 Number of Sequences: 336 Number of extensions: 3563 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19571740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -