BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0128 (731 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6295| Best HMM Match : WSC (HMM E-Value=3.8e-10) 32 0.42 SB_40651| Best HMM Match : Neuromodulin (HMM E-Value=1.2) 28 6.8 >SB_6295| Best HMM Match : WSC (HMM E-Value=3.8e-10) Length = 281 Score = 32.3 bits (70), Expect = 0.42 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = -2 Query: 673 ADDALSEGCQGKSSIRCGQNLLVSDY 596 AD + S GCQG S+++CG +++ S Y Sbjct: 86 ADSSCSYGCQGNSNLKCGGSMINSVY 111 >SB_40651| Best HMM Match : Neuromodulin (HMM E-Value=1.2) Length = 1156 Score = 28.3 bits (60), Expect = 6.8 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = -3 Query: 243 SPGHDNTLLITGLSGHGFKFASVLGEIAADFAQDKKSD 130 SPG N L++T + G K AS + D ++KK D Sbjct: 475 SPGRKNILIVTRKTSSGEKPASATEKNGKDVGREKKMD 512 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,674,839 Number of Sequences: 59808 Number of extensions: 451798 Number of successful extensions: 1082 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1024 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1082 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1962001171 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -