BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0127 (767 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-deca... 31 0.013 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 23 2.0 AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 23 2.0 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 23 2.0 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 22 6.2 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 22 6.2 AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 21 8.2 AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein p... 21 8.2 AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein p... 21 8.2 >EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-decarboxylase protein. Length = 540 Score = 30.7 bits (66), Expect = 0.013 Identities = 24/88 (27%), Positives = 43/88 (48%), Gaps = 4/88 (4%) Frame = +1 Query: 505 MTTNTELVWLKRAAACPIMNIHSEYTNSFESFVNRVIWEELLQTP-SVYIRHRLWP---K 672 ++++ EL K PI + S+ SFES NR + EE L++ V ++ ++ + Sbjct: 26 LSSDEELFHQKCPKPAPIYSPVSKPV-SFESLPNRRLHEEFLRSSVDVLLQEAVFEGTNR 84 Query: 673 KKEILNWRFLFGFSK*REFGTQTRPLVH 756 K +L WR + +FG ++ P H Sbjct: 85 KNRVLQWREPEELRRLMDFGVRSAPSTH 112 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 23.4 bits (48), Expect = 2.0 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +3 Query: 516 YRISLAKKGGGLPNHEHPQ 572 Y+++ K LP H HPQ Sbjct: 366 YQVNPTKTRTNLPTHRHPQ 384 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 23.4 bits (48), Expect = 2.0 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = -3 Query: 693 PIKDFLLLRPESVPNVNRWGL*KFLPYDAVHKRLERVGVLAVDVH 559 P+ D LLL ES ++ G +FLP +E GVL + H Sbjct: 224 PLSDQLLLLEESWLDLFVLGAAQFLPLMDFSVLVEACGVLQQEPH 268 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 23.4 bits (48), Expect = 2.0 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = -3 Query: 693 PIKDFLLLRPESVPNVNRWGL*KFLPYDAVHKRLERVGVLAVDVH 559 P+ D LLL ES ++ G +FLP +E GVL + H Sbjct: 224 PLSDQLLLLEESWLDLFVLGAAQFLPLMDFSVLVEACGVLQQEPH 268 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 21.8 bits (44), Expect = 6.2 Identities = 7/22 (31%), Positives = 14/22 (63%) Frame = +1 Query: 196 LFRTGQKPKTYPF*RNSQCEPD 261 L R G+K ++PF + ++ P+ Sbjct: 200 LLRNGEKHHSFPFRKTTEIPPE 221 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.8 bits (44), Expect = 6.2 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 448 EEDYVPHEVIRIVEPSY 498 E+ Y+ EV+R+ +P Y Sbjct: 337 EKKYILQEVVRVKKPHY 353 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 21.4 bits (43), Expect = 8.2 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = -3 Query: 378 EVHVHHLLVVYNGEAVLNKTGPSFT 304 EV+ HH + + + +TG S+T Sbjct: 62 EVYYHHQTIPQDNPIINTETGLSYT 86 >AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein protein. Length = 210 Score = 21.4 bits (43), Expect = 8.2 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = -3 Query: 378 EVHVHHLLVVYNGEAVLNKTGPSFT 304 EV+ HH + + + +TG S+T Sbjct: 62 EVYYHHQTIPQDNPIINTETGLSYT 86 >AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein protein. Length = 253 Score = 21.4 bits (43), Expect = 8.2 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = -3 Query: 378 EVHVHHLLVVYNGEAVLNKTGPSFT 304 EV+ HH + + + +TG S+T Sbjct: 62 EVYYHHQTIPQDNPIINTETGLSYT 86 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 204,209 Number of Sequences: 336 Number of extensions: 5070 Number of successful extensions: 13 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20650031 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -