BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= ce--0127
(767 letters)
Database: spombe
5004 sequences; 2,362,478 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
SPCC757.07c |ctt1|cta1|catalase|Schizosaccharomyces pombe|chr 3|... 29 0.97
SPAPJ691.02 |||yippee-like protein|Schizosaccharomyces pombe|chr... 28 1.3
SPCC4F11.03c |||sequence orphan|Schizosaccharomyces pombe|chr 3|... 27 2.2
SPAC4G8.09 |||mitochondrial leucine-tRNA ligase|Schizosaccharomy... 26 5.2
SPAC4F10.04 |||protein phosphatase type 2A, intrinsic regulator ... 26 6.8
SPBC16G5.12c |top3||DNA topoisomerase III|Schizosaccharomyces po... 26 6.8
SPBC29B5.02c |isp4||OPT oligopeptide transporter family |Schizos... 25 9.0
>SPCC757.07c |ctt1|cta1|catalase|Schizosaccharomyces pombe|chr
3|||Manual
Length = 512
Score = 28.7 bits (61), Expect = 0.97
Identities = 11/25 (44%), Positives = 13/25 (52%)
Frame = -1
Query: 623 SSHMTRFTNDSNELVYSLWMFMIGQ 549
SSH +F ND E Y W F+ Q
Sbjct: 202 SSHTYKFVNDKGEFYYCKWHFITNQ 226
>SPAPJ691.02 |||yippee-like protein|Schizosaccharomyces pombe|chr
1|||Manual
Length = 131
Score = 28.3 bits (60), Expect = 1.3
Identities = 8/16 (50%), Positives = 11/16 (68%)
Frame = -3
Query: 519 CIRCHAHVGWLHNSDY 472
C RCH ++GW + S Y
Sbjct: 72 CCRCHTYIGWKYVSSY 87
>SPCC4F11.03c |||sequence orphan|Schizosaccharomyces pombe|chr
3|||Manual
Length = 335
Score = 27.5 bits (58), Expect = 2.2
Identities = 16/43 (37%), Positives = 21/43 (48%)
Frame = +1
Query: 373 YLVANLKPTRPNRCYKFLAQHALRWEEDYVPHEVIRIVEPSYV 501
YL+ +L PN Y Q A + +DY E IRI+E V
Sbjct: 32 YLLRSLLANVPNALYHSQLQAACQKFQDYCDLEEIRIIEAKRV 74
>SPAC4G8.09 |||mitochondrial leucine-tRNA ligase|Schizosaccharomyces
pombe|chr 1|||Manual
Length = 874
Score = 26.2 bits (55), Expect = 5.2
Identities = 13/43 (30%), Positives = 24/43 (55%), Gaps = 4/43 (9%)
Frame = +1
Query: 259 DTMKLIVNWSGK-EFLRETW---TRFVEDSFPIVNDQEVMDVY 375
D ++ + W K + ++ W T E SFP++ND+E + V+
Sbjct: 230 DDLETLPKWPDKVKKMQRNWIGRTTGFEISFPLLNDKETLTVF 272
>SPAC4F10.04 |||protein phosphatase type 2A, intrinsic regulator
|Schizosaccharomyces pombe|chr 1|||Manual
Length = 325
Score = 25.8 bits (54), Expect = 6.8
Identities = 16/54 (29%), Positives = 26/54 (48%)
Frame = +3
Query: 489 AILRGHDNEYRISLAKKGGGLPNHEHPQRVHQLVRVVCEPRHMGGTSTNPIGLH 650
A R D R+++A G + E+ RV +LVR++C + + T G H
Sbjct: 44 AYYRIFDFLQRLNIASVGVNDYHVEYSTRVEKLVRILCRVKEITKTVPPASGRH 97
>SPBC16G5.12c |top3||DNA topoisomerase III|Schizosaccharomyces
pombe|chr 2|||Manual
Length = 622
Score = 25.8 bits (54), Expect = 6.8
Identities = 15/48 (31%), Positives = 24/48 (50%)
Frame = +2
Query: 11 PINMPNYSYTPTIGRTYVYDNKYYKNLGCLIKNAKRKKHLVEHEQEEK 154
P+ M + S P+ VY+ + L C NAK + LV+ + EE+
Sbjct: 387 PVQMVHRSALPSQDHWKVYELITRRFLACCSDNAKGAETLVQVKMEEE 434
>SPBC29B5.02c |isp4||OPT oligopeptide transporter family
|Schizosaccharomyces pombe|chr 2|||Manual
Length = 785
Score = 25.4 bits (53), Expect = 9.0
Identities = 8/33 (24%), Positives = 19/33 (57%)
Frame = -3
Query: 480 SDYFVGHVVFFPPKSVLSEELVAPVGACGFEVG 382
+D GH + PP+ + +++A + +C ++G
Sbjct: 558 ADLKFGHYMKLPPRIMFYTQMIATIWSCFVQIG 590
Database: spombe
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 2,362,478
Number of sequences in database: 5004
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,555,246
Number of Sequences: 5004
Number of extensions: 80740
Number of successful extensions: 254
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 240
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 254
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 369323696
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -