BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0127 (767 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC757.07c |ctt1|cta1|catalase|Schizosaccharomyces pombe|chr 3|... 29 0.97 SPAPJ691.02 |||yippee-like protein|Schizosaccharomyces pombe|chr... 28 1.3 SPCC4F11.03c |||sequence orphan|Schizosaccharomyces pombe|chr 3|... 27 2.2 SPAC4G8.09 |||mitochondrial leucine-tRNA ligase|Schizosaccharomy... 26 5.2 SPAC4F10.04 |||protein phosphatase type 2A, intrinsic regulator ... 26 6.8 SPBC16G5.12c |top3||DNA topoisomerase III|Schizosaccharomyces po... 26 6.8 SPBC29B5.02c |isp4||OPT oligopeptide transporter family |Schizos... 25 9.0 >SPCC757.07c |ctt1|cta1|catalase|Schizosaccharomyces pombe|chr 3|||Manual Length = 512 Score = 28.7 bits (61), Expect = 0.97 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -1 Query: 623 SSHMTRFTNDSNELVYSLWMFMIGQ 549 SSH +F ND E Y W F+ Q Sbjct: 202 SSHTYKFVNDKGEFYYCKWHFITNQ 226 >SPAPJ691.02 |||yippee-like protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 131 Score = 28.3 bits (60), Expect = 1.3 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -3 Query: 519 CIRCHAHVGWLHNSDY 472 C RCH ++GW + S Y Sbjct: 72 CCRCHTYIGWKYVSSY 87 >SPCC4F11.03c |||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 335 Score = 27.5 bits (58), Expect = 2.2 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = +1 Query: 373 YLVANLKPTRPNRCYKFLAQHALRWEEDYVPHEVIRIVEPSYV 501 YL+ +L PN Y Q A + +DY E IRI+E V Sbjct: 32 YLLRSLLANVPNALYHSQLQAACQKFQDYCDLEEIRIIEAKRV 74 >SPAC4G8.09 |||mitochondrial leucine-tRNA ligase|Schizosaccharomyces pombe|chr 1|||Manual Length = 874 Score = 26.2 bits (55), Expect = 5.2 Identities = 13/43 (30%), Positives = 24/43 (55%), Gaps = 4/43 (9%) Frame = +1 Query: 259 DTMKLIVNWSGK-EFLRETW---TRFVEDSFPIVNDQEVMDVY 375 D ++ + W K + ++ W T E SFP++ND+E + V+ Sbjct: 230 DDLETLPKWPDKVKKMQRNWIGRTTGFEISFPLLNDKETLTVF 272 >SPAC4F10.04 |||protein phosphatase type 2A, intrinsic regulator |Schizosaccharomyces pombe|chr 1|||Manual Length = 325 Score = 25.8 bits (54), Expect = 6.8 Identities = 16/54 (29%), Positives = 26/54 (48%) Frame = +3 Query: 489 AILRGHDNEYRISLAKKGGGLPNHEHPQRVHQLVRVVCEPRHMGGTSTNPIGLH 650 A R D R+++A G + E+ RV +LVR++C + + T G H Sbjct: 44 AYYRIFDFLQRLNIASVGVNDYHVEYSTRVEKLVRILCRVKEITKTVPPASGRH 97 >SPBC16G5.12c |top3||DNA topoisomerase III|Schizosaccharomyces pombe|chr 2|||Manual Length = 622 Score = 25.8 bits (54), Expect = 6.8 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +2 Query: 11 PINMPNYSYTPTIGRTYVYDNKYYKNLGCLIKNAKRKKHLVEHEQEEK 154 P+ M + S P+ VY+ + L C NAK + LV+ + EE+ Sbjct: 387 PVQMVHRSALPSQDHWKVYELITRRFLACCSDNAKGAETLVQVKMEEE 434 >SPBC29B5.02c |isp4||OPT oligopeptide transporter family |Schizosaccharomyces pombe|chr 2|||Manual Length = 785 Score = 25.4 bits (53), Expect = 9.0 Identities = 8/33 (24%), Positives = 19/33 (57%) Frame = -3 Query: 480 SDYFVGHVVFFPPKSVLSEELVAPVGACGFEVG 382 +D GH + PP+ + +++A + +C ++G Sbjct: 558 ADLKFGHYMKLPPRIMFYTQMIATIWSCFVQIG 590 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,555,246 Number of Sequences: 5004 Number of extensions: 80740 Number of successful extensions: 254 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 240 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 254 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 369323696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -