BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0125 (694 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 2.8 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 22 6.4 DQ435324-1|ABD92639.1| 152|Apis mellifera OBP3 protein. 21 8.4 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 8.4 AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C prot... 21 8.4 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.0 bits (47), Expect = 2.8 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +1 Query: 349 LRVAPEEHPVLLTEAPLNPKANREKM 426 LR+ P H V+ T +NP + EK+ Sbjct: 1461 LRLGPCWHAVMTTYPRINPDNHNEKL 1486 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.8 bits (44), Expect = 6.4 Identities = 14/53 (26%), Positives = 21/53 (39%) Frame = +1 Query: 472 AIQAVLSLYASGLPPVSCWTPATVSSTPCPSTRDTHSPTPSLRLDFGPVRDLT 630 A +L SG P ++ + P SP+PS R GP + L+ Sbjct: 845 ASSTAATLVLSGCPSNMMELQVDIADSQQPLNLSKKSPSPSPRPLVGPCKALS 897 >DQ435324-1|ABD92639.1| 152|Apis mellifera OBP3 protein. Length = 152 Score = 21.4 bits (43), Expect = 8.4 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = -1 Query: 256 LFALCLISYIRV 221 LF LC++SY+ V Sbjct: 8 LFTLCIVSYMMV 19 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 8.4 Identities = 11/42 (26%), Positives = 16/42 (38%) Frame = +2 Query: 470 SPSKPCSRCTRPVYHRYRAGLRRRCLPHRAHLRGIRTPPRHP 595 S ++ T +HR C P +L I + P HP Sbjct: 55 SGTRSSESLTAQAHHRLYPAFSSSCDPVPGNLEQIGSRPLHP 96 >AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C protein. Length = 149 Score = 21.4 bits (43), Expect = 8.4 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +2 Query: 113 GMCKAGFAGD 142 GMCK G +GD Sbjct: 130 GMCKEGISGD 139 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 222,355 Number of Sequences: 438 Number of extensions: 5463 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21195810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -