BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0124 (919 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3919| Best HMM Match : No HMM Matches (HMM E-Value=.) 129 3e-30 SB_3774| Best HMM Match : DivIC (HMM E-Value=4.4) 109 4e-24 SB_33584| Best HMM Match : No HMM Matches (HMM E-Value=.) 89 4e-18 SB_9909| Best HMM Match : AAA (HMM E-Value=0) 89 5e-18 SB_35973| Best HMM Match : zf-CCHC (HMM E-Value=0.0026) 81 9e-16 SB_33442| Best HMM Match : AAA (HMM E-Value=0) 73 2e-13 SB_14682| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_48561| Best HMM Match : AAA (HMM E-Value=0) 59 4e-09 SB_40956| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_45627| Best HMM Match : AAA (HMM E-Value=0) 57 2e-08 SB_37200| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_19460| Best HMM Match : AAA (HMM E-Value=0) 54 1e-07 SB_30385| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_33907| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_17703| Best HMM Match : Mito_carr (HMM E-Value=0) 43 4e-04 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_49367| Best HMM Match : AAA (HMM E-Value=0) 38 0.011 SB_28977| Best HMM Match : AAA (HMM E-Value=0) 38 0.015 SB_20114| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_7424| Best HMM Match : AAA (HMM E-Value=0) 37 0.026 SB_3006| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 36 0.046 SB_35704| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_28183| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.061 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 35 0.080 SB_45949| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_39278| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 34 0.14 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 34 0.14 SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) 34 0.14 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 34 0.19 SB_35112| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_34686| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_32003| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_21711| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_5903| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_3115| Best HMM Match : AAA (HMM E-Value=0) 33 0.24 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 33 0.32 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 33 0.32 SB_30021| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 33 0.32 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 33 0.32 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 33 0.32 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_51469| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_46663| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_44783| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_40947| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_39848| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_38869| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_32543| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_22547| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_11000| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) 33 0.32 SB_6274| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_3084| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_876| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_343| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.43 SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.43 SB_21311| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.43 SB_21097| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.43 SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.43 SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.43 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.56 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.56 SB_55690| Best HMM Match : AAA (HMM E-Value=0) 32 0.56 SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.56 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.56 SB_34430| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.56 SB_23253| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.56 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.56 SB_17566| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.56 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.75 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.75 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.75 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.75 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.75 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.75 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.75 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.75 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.75 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.75 SB_47774| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.75 SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.75 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.75 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 32 0.75 SB_36996| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.75 SB_36738| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.75 SB_36586| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.75 SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.75 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.75 SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.75 SB_7708| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.75 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 31 0.99 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 31 0.99 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_40987| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_29704| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_22214| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_16765| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_13994| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_5222| Best HMM Match : Ras (HMM E-Value=2.9e-09) 31 0.99 SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_46791| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_40734| Best HMM Match : DUF765 (HMM E-Value=0.42) 31 1.3 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_20081| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_16436| Best HMM Match : DUF765 (HMM E-Value=9.2) 31 1.3 SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_6342| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_5062| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 31 1.7 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 31 1.7 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 31 1.7 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 31 1.7 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 31 1.7 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 31 1.7 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 31 1.7 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 31 1.7 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 31 1.7 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 31 1.7 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 31 1.7 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 31 1.7 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 31 1.7 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 31 1.7 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 31 1.7 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 31 1.7 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 31 1.7 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 31 1.7 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 31 1.7 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 31 1.7 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 31 1.7 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 31 1.7 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_12682| Best HMM Match : DUF1336 (HMM E-Value=3.2) 31 1.7 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 31 1.7 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 31 1.7 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 31 1.7 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 31 1.7 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 31 1.7 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 31 1.7 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 31 1.7 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 31 1.7 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_54347| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 31 1.7 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_53321| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_52633| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_52165| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_51470| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_51374| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_50614| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) 31 1.7 SB_49267| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_49082| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_48925| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_48900| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_48334| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_47996| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_47610| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_47580| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_47576| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_47430| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_47128| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_47127| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_46688| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_46485| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) 31 1.7 SB_46157| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_45961| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_45308| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_44850| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_44611| Best HMM Match : DUF765 (HMM E-Value=2.6) 31 1.7 SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_44084| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_43717| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_43349| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_43046| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 31 1.7 SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_42545| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_42492| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_42272| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_42248| Best HMM Match : Keratin_B2 (HMM E-Value=4.4) 31 1.7 SB_42077| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_41735| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_41531| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_41224| Best HMM Match : DUF765 (HMM E-Value=3.5) 31 1.7 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_40885| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_39977| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_39773| Best HMM Match : DUF765 (HMM E-Value=4.1) 31 1.7 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_39410| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_39409| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_39375| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_39260| Best HMM Match : DUF765 (HMM E-Value=9.6) 31 1.7 >SB_3919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 442 Score = 129 bits (312), Expect = 3e-30 Identities = 61/71 (85%), Positives = 66/71 (92%) Frame = +2 Query: 530 KVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLY 709 +VDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELF+ALGI QPKGVLLY Sbjct: 158 EVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIDQPKGVLLY 217 Query: 710 GPSGPWKDIIS 742 GP G K +++ Sbjct: 218 GPPGTGKTLLA 228 Score = 110 bits (265), Expect = 1e-24 Identities = 53/71 (74%), Positives = 59/71 (83%) Frame = +3 Query: 255 KSQNLRRLQAQRNELNAKVRMLRXXXXXXXXXGSYVGEVVKPMDKKKVLVKVHPEGKFVV 434 K +NLRRL+AQRNELNAKVRMLR GSYVGEVVKPMDKKKVLVKVHPEGKFVV Sbjct: 89 KIKNLRRLEAQRNELNAKVRMLREELQLLQEQGSYVGEVVKPMDKKKVLVKVHPEGKFVV 148 Query: 435 DLDKNVDINDV 467 D+DK +D+ +V Sbjct: 149 DIDKGIDMAEV 159 Score = 58.0 bits (134), Expect = 1e-08 Identities = 36/68 (52%), Positives = 41/68 (60%) Frame = +3 Query: 675 LGLRNQKESYCMGLPGPGKTLLARAVAHHMRCTFIRGSXIRNWYQKFIGRKAAKMGAERL 854 LG+ K G PG GKTLLARAVAHH CTFIR S QKFIG + A+M E L Sbjct: 206 LGIDQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSG-SELVQKFIG-EGARMVRE-L 262 Query: 855 FVMGQRNK 878 FVM + + Sbjct: 263 FVMARHGE 270 >SB_3774| Best HMM Match : DivIC (HMM E-Value=4.4) Length = 158 Score = 109 bits (261), Expect = 4e-24 Identities = 52/68 (76%), Positives = 57/68 (83%) Frame = +3 Query: 255 KSQNLRRLQAQRNELNAKVRMLRXXXXXXXXXGSYVGEVVKPMDKKKVLVKVHPEGKFVV 434 K +NLRRL+AQRNELNAKVRMLR GSYVGEVVKPMDKKKVLVKVHPEGKFVV Sbjct: 89 KIKNLRRLEAQRNELNAKVRMLREELQLLQEQGSYVGEVVKPMDKKKVLVKVHPEGKFVV 148 Query: 435 DLDKNVDI 458 D+DK +D+ Sbjct: 149 DIDKGIDM 156 >SB_33584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 455 Score = 89.4 bits (212), Expect = 4e-18 Identities = 37/75 (49%), Positives = 55/75 (73%) Frame = +2 Query: 518 ILPNKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKG 697 +L + DP+V++M +EK P +Y +GGLD QI+EIKE +ELP+ HPEL++ +GI PKG Sbjct: 357 VLSDDADPMVTVMKLEKAPQESYADIGGLDTQIQEIKESVELPLTHPELYEEMGIKPPKG 416 Query: 698 VLLYGPSGPWKDIIS 742 V+LYG G K +++ Sbjct: 417 VILYGQPGTGKTLLA 431 Score = 37.1 bits (82), Expect = 0.020 Identities = 17/36 (47%), Positives = 23/36 (63%) Frame = +3 Query: 675 LGLRNQKESYCMGLPGPGKTLLARAVAHHMRCTFIR 782 +G++ K G PG GKTLLA+AVA+ TF+R Sbjct: 409 MGIKPPKGVILYGQPGTGKTLLAKAVANQTSATFLR 444 >SB_9909| Best HMM Match : AAA (HMM E-Value=0) Length = 400 Score = 89.0 bits (211), Expect = 5e-18 Identities = 40/81 (49%), Positives = 55/81 (67%) Frame = +2 Query: 494 QRKLYLHKILPNKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDA 673 + K +H LP K+DP V++M VE+ PD TY +GG +QI +++EV+E P+ HPE F Sbjct: 53 RNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDIGGCKEQIDKLREVVETPLLHPERFVN 112 Query: 674 LGIAQPKGVLLYGPSGPWKDI 736 LGI PKGVLL+GP G K + Sbjct: 113 LGIEPPKGVLLFGPPGTGKTL 133 Score = 39.5 bits (88), Expect = 0.004 Identities = 30/70 (42%), Positives = 38/70 (54%), Gaps = 2/70 (2%) Frame = +3 Query: 675 LGLRNQKESYCMGLPGPGKTLLARAVAHHMRCTFIR--GSXIRNWYQKFIGRKAAKMGAE 848 LG+ K G PG GKTL ARAVA+ FIR GS + QK++G + A+M E Sbjct: 113 LGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSEL---VQKYVG-EGARMVRE 168 Query: 849 RLFVMGQRNK 878 LF M + K Sbjct: 169 -LFEMARTKK 177 >SB_35973| Best HMM Match : zf-CCHC (HMM E-Value=0.0026) Length = 779 Score = 81.4 bits (192), Expect = 9e-16 Identities = 39/73 (53%), Positives = 52/73 (71%) Frame = +2 Query: 503 LYLHKILPNKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGI 682 L + + LP +VDPLV M E + +Y VGGL +QI+E++EVIELP+ +PELF +GI Sbjct: 107 LTIMRYLPREVDPLVYNMSHEDPGNISYSDVGGLSEQIRELREVIELPLTNPELFQRVGI 166 Query: 683 AQPKGVLLYGPSG 721 A PKG LL+GP G Sbjct: 167 APPKGCLLFGPPG 179 >SB_33442| Best HMM Match : AAA (HMM E-Value=0) Length = 369 Score = 73.3 bits (172), Expect = 2e-13 Identities = 32/75 (42%), Positives = 52/75 (69%) Frame = +2 Query: 518 ILPNKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKG 697 ILP + D ++++ E+ P+ +Y +GG+D Q +EI+E +ELP+ H EL+ +GI P+G Sbjct: 141 ILPPEADSSIAMLTNEEKPNVSYAEIGGMDIQKQEIREAVELPLTHFELYKQIGIDPPRG 200 Query: 698 VLLYGPSGPWKDIIS 742 VLLYGP G K +++ Sbjct: 201 VLLYGPPGCGKTMLA 215 Score = 39.1 bits (87), Expect = 0.005 Identities = 23/57 (40%), Positives = 33/57 (57%) Frame = +3 Query: 711 GLPGPGKTLLARAVAHHMRCTFIRGSXIRNWYQKFIGRKAAKMGAERLFVMGQRNKP 881 G PG GKT+LA+AVAHH FIR + QK++G + +M +F + + N P Sbjct: 205 GPPGCGKTMLAKAVAHHTTAAFIRVVG-SEFVQKYLG-EGPRM-VRDVFRLAKENAP 258 >SB_14682| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 802 Score = 68.5 bits (160), Expect = 7e-12 Identities = 28/65 (43%), Positives = 46/65 (70%) Frame = +2 Query: 581 TYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPSGPWKDIISSCCRSP 760 +++ +GGL QI+ ++E+IE+P+ +PELF A G+ P+G+LLYGPSG K +I+ + Sbjct: 254 SFQSIGGLKTQIQAVREMIEMPLTNPELFTAYGVPPPRGILLYGPSGTGKTMIARAVANE 313 Query: 761 HEVYF 775 V+F Sbjct: 314 TGVHF 318 Score = 61.7 bits (143), Expect = 8e-10 Identities = 37/111 (33%), Positives = 55/111 (49%) Frame = +2 Query: 566 KVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPSGPWKDIISS 745 +VP + VGG + +++KE +E P+KHPE F LGI P+G+L+YGP G K +I+ Sbjct: 530 EVPKVHWSDVGGNEMIKRKLKEAVEWPLKHPEAFQRLGIRPPRGILMYGPPGCSKTLIAR 589 Query: 746 CCRSPHEVYFHTWFXDQKLVPKIYWEKGSQNGCREALRNGPKKQAPXFXFF 898 + + F +L K W S+ RE + AP FF Sbjct: 590 ALATESGLNFIA-IKGPELFSK--WVGESEKAVREVFLKA-RATAPSIVFF 636 >SB_48561| Best HMM Match : AAA (HMM E-Value=0) Length = 2021 Score = 59.3 bits (137), Expect = 4e-09 Identities = 24/53 (45%), Positives = 38/53 (71%) Frame = +2 Query: 584 YEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPSGPWKDIIS 742 ++ VGGL+KQI+ +KE+I P+ +PE+FD I P+GVL +GP G K +++ Sbjct: 883 FDSVGGLNKQIQALKEMILFPLVYPEVFDKFKITPPRGVLFFGPPGTGKTLVA 935 >SB_40956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1086 Score = 58.0 bits (134), Expect = 1e-08 Identities = 29/59 (49%), Positives = 42/59 (71%) Frame = +2 Query: 566 KVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPSGPWKDIIS 742 K+PD +++ VGGLD +EI + I+LP+ HPELF A G+ + GVLLYGP G K +++ Sbjct: 805 KIPDISWKDVGGLDSVKEEILDTIQLPLLHPELF-AAGLRR-SGVLLYGPPGTGKTLMA 861 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Frame = +3 Query: 711 GLPGPGKTLLARAVAHHMRCTF--IRGSXIRNWY 806 G PG GKTL+A+AVA F ++G + N Y Sbjct: 851 GPPGTGKTLMAKAVATECSLNFLSVKGPELINMY 884 >SB_45627| Best HMM Match : AAA (HMM E-Value=0) Length = 628 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/72 (33%), Positives = 45/72 (62%) Frame = +2 Query: 560 VEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPSGPWKDII 739 V +VP+ +++ +GGL+ +E++E+++ PV+HP+ F G+ KGVL YGP G K ++ Sbjct: 301 VVEVPNVSWDDIGGLEGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLL 360 Query: 740 SSCCRSPHEVYF 775 + + + F Sbjct: 361 AKAIANECQANF 372 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +3 Query: 669 MPLGLRNQKESYCMGLPGPGKTLLARAVAHHMRCTFI 779 + G+ K G PG GKTLLA+A+A+ + FI Sbjct: 337 LKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFI 373 >SB_37200| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 908 Score = 54.4 bits (125), Expect = 1e-07 Identities = 25/69 (36%), Positives = 43/69 (62%), Gaps = 1/69 (1%) Frame = +2 Query: 560 VEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPSGPWK-DI 736 V ++ + ++ VGGL+ + +++ IE P+ HPE F +G+ +P+GVLLYGP G K + Sbjct: 475 VVRLQPTRWDDVGGLEGVKQALRQAIEWPLLHPEAFARMGLRRPRGVLLYGPPGCCKTTL 534 Query: 737 ISSCCRSPH 763 + + S H Sbjct: 535 VRAAASSTH 543 Score = 53.2 bits (122), Expect = 3e-07 Identities = 26/74 (35%), Positives = 42/74 (56%) Frame = +2 Query: 518 ILPNKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKG 697 ++ K + + + V DS ++ GLD IK +KE+++ P+ +PE F LGI PKG Sbjct: 188 VITEKTNINIESVKVGSSVDSGNIILSGLDDSIKMLKELVQFPLYYPESFSHLGINGPKG 247 Query: 698 VLLYGPSGPWKDII 739 +LL G G K ++ Sbjct: 248 ILLVGAPGVGKTLL 261 Score = 30.3 bits (65), Expect = 2.3 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = +3 Query: 675 LGLRNQKESYCMGLPGPGKTLLARAVAHHMRCTFI 779 +GLR + G PG KT L RA A CTF+ Sbjct: 513 MGLRRPRGVLLYGPPGCCKTTLVRAAASSTHCTFM 547 >SB_19460| Best HMM Match : AAA (HMM E-Value=0) Length = 340 Score = 54.4 bits (125), Expect = 1e-07 Identities = 25/69 (36%), Positives = 43/69 (62%), Gaps = 1/69 (1%) Frame = +2 Query: 560 VEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPSGPWK-DI 736 V ++ + ++ VGGL+ + +++ IE P+ HPE F +G+ +P+GVLLYGP G K + Sbjct: 4 VVRLQPTRWDDVGGLEGVKQALRQAIEWPLLHPEAFARMGLRRPRGVLLYGPPGCCKTTL 63 Query: 737 ISSCCRSPH 763 + + S H Sbjct: 64 VRAAASSTH 72 Score = 31.1 bits (67), Expect = 1.3 Identities = 21/69 (30%), Positives = 31/69 (44%) Frame = +3 Query: 675 LGLRNQKESYCMGLPGPGKTLLARAVAHHMRCTFIRGSXIRNWYQKFIGRKAAKMGAERL 854 +GLR + G PG KT L RA A CTF+ S + + ++G A+ L Sbjct: 42 MGLRRPRGVLLYGPPGCCKTTLVRAAASSTHCTFMSLSCAQ-LFSSYVG--DAERTLREL 98 Query: 855 FVMGQRNKP 881 F+ + P Sbjct: 99 FLKARATAP 107 >SB_30385| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 53.2 bits (122), Expect = 3e-07 Identities = 26/74 (35%), Positives = 42/74 (56%) Frame = +2 Query: 518 ILPNKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKG 697 ++ K + + + V DS ++ GLD IK +KE+++ P+ +PE F LGI PKG Sbjct: 18 VITEKTNINIESVKVGSSVDSGNIILSGLDDSIKMLKELVQFPLYYPESFSHLGINGPKG 77 Query: 698 VLLYGPSGPWKDII 739 +LL G G K ++ Sbjct: 78 ILLVGAPGVGKTLL 91 >SB_33907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 42.7 bits (96), Expect = 4e-04 Identities = 18/44 (40%), Positives = 26/44 (59%) Frame = +2 Query: 644 PVKHPELFDALGIAQPKGVLLYGPSGPWKDIISSCCRSPHEVYF 775 PV+HPE F ALG+ P G+LL GP G K +++ + + F Sbjct: 2 PVQHPEEFSALGLTHPPGILLAGPPGCGKTLLAKAIANESGINF 45 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/35 (45%), Positives = 20/35 (57%) Frame = +3 Query: 675 LGLRNQKESYCMGLPGPGKTLLARAVAHHMRCTFI 779 LGL + G PG GKTLLA+A+A+ FI Sbjct: 12 LGLTHPPGILLAGPPGCGKTLLAKAIANESGINFI 46 >SB_17703| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 611 Score = 42.7 bits (96), Expect = 4e-04 Identities = 18/44 (40%), Positives = 26/44 (59%) Frame = +2 Query: 644 PVKHPELFDALGIAQPKGVLLYGPSGPWKDIISSCCRSPHEVYF 775 PV+HPE F ALG+ P G+LL GP G K +++ + + F Sbjct: 2 PVQHPEEFSALGLTHPPGILLAGPPGCGKTLLAKAIANESGINF 45 Score = 32.7 bits (71), Expect = 0.43 Identities = 19/46 (41%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Frame = +3 Query: 675 LGLRNQKESYCMGLPGPGKTLLARAVAHHMRCTFI--RGSXIRNWY 806 LGL + G PG GKTLLA+A+A+ FI +G + N Y Sbjct: 12 LGLTHPPGILLAGPPGCGKTLLAKAIANESGINFISVKGPELLNMY 57 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 86 PRPPNSCSPGDPLVLE 39 PRP NSCSPGDPLVLE Sbjct: 24 PRPSNSCSPGDPLVLE 39 >SB_49367| Best HMM Match : AAA (HMM E-Value=0) Length = 976 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/61 (27%), Positives = 34/61 (55%) Frame = +2 Query: 593 VGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPSGPWKDIISSCCRSPHEVY 772 +GG ++++ +++ + + HPE+F LG+ G LL+GP G K +++ E+ Sbjct: 679 IGGCSNTLEQVGKLL-VHMCHPEVFTTLGVTPTTGFLLHGPPGCGKTLLAHAIAGELEMP 737 Query: 773 F 775 F Sbjct: 738 F 738 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +3 Query: 711 GLPGPGKTLLARAVAHHMRCTFIR 782 G PG GKTLLA A+A + F++ Sbjct: 717 GPPGCGKTLLAHAIAGELEMPFLK 740 >SB_28977| Best HMM Match : AAA (HMM E-Value=0) Length = 442 Score = 37.5 bits (83), Expect = 0.015 Identities = 22/58 (37%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Frame = +2 Query: 542 LVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQP-KGVLLYG 712 L S +++EK P+ + + GL+ + +KE + LP+K P LF G P +G+LLYG Sbjct: 83 LNSAIVMEK-PNVKWSDIAGLESAKEALKEAVILPIKFPHLF--TGKRTPWRGILLYG 137 >SB_20114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 36.7 bits (81), Expect = 0.026 Identities = 18/28 (64%), Positives = 21/28 (75%) Frame = -3 Query: 122 ITNVRF*LSKMDPRPPNSCSPGDPLVLE 39 +TN R + K+ P P NSCSPGDPLVLE Sbjct: 7 VTN-RDTIYKVLPAPSNSCSPGDPLVLE 33 >SB_7424| Best HMM Match : AAA (HMM E-Value=0) Length = 294 Score = 36.7 bits (81), Expect = 0.026 Identities = 20/61 (32%), Positives = 33/61 (54%) Frame = +2 Query: 560 VEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPSGPWKDII 739 V V +S + V G ++ EI E + +K+P+ + LG PKG +L GP G K ++ Sbjct: 39 VTYVKESEWIDVAGCEEAKLEIMEFVNF-LKNPQQYHELGAKIPKGAILSGPPGTGKTLL 97 Query: 740 S 742 + Sbjct: 98 A 98 Score = 35.9 bits (79), Expect = 0.046 Identities = 24/69 (34%), Positives = 35/69 (50%) Frame = +3 Query: 675 LGLRNQKESYCMGLPGPGKTLLARAVAHHMRCTFIRGSXIRNWYQKFIGRKAAKMGAERL 854 LG + K + G PG GKTLLA+AVA F+ S + + F+G A++ L Sbjct: 76 LGAKIPKGAILSGPPGTGKTLLAKAVAGEAGVPFLSISG-SEFLEMFVGVGPARV--RDL 132 Query: 855 FVMGQRNKP 881 F ++N P Sbjct: 133 FAQARKNAP 141 >SB_3006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 86 PRPPNSCSPGDPLVLE 39 P+P NSCSPGDPLVLE Sbjct: 12 PKPSNSCSPGDPLVLE 27 >SB_14086| Best HMM Match : POR (HMM E-Value=7.7) Length = 292 Score = 35.9 bits (79), Expect = 0.046 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -3 Query: 86 PRPPNSCSPGDPLVLE 39 P P NSCSPGDPLVLE Sbjct: 166 PEPSNSCSPGDPLVLE 181 >SB_35704| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 256 Score = 35.9 bits (79), Expect = 0.046 Identities = 18/47 (38%), Positives = 30/47 (63%) Frame = +2 Query: 602 LDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPSGPWKDIIS 742 +D+ +E++EV+E +++PE F LG P GVLL G G K +++ Sbjct: 136 VDEAKEELQEVVEF-LRNPEKFKRLGGKLPTGVLLIGSPGTGKTLLA 181 Score = 31.1 bits (67), Expect = 1.3 Identities = 21/58 (36%), Positives = 30/58 (51%) Frame = +3 Query: 708 MGLPGPGKTLLARAVAHHMRCTFIRGSXIRNWYQKFIGRKAAKMGAERLFVMGQRNKP 881 +G PG GKTLLA+AVA F S + + F+G AA++ LF + + P Sbjct: 170 IGSPGTGKTLLAKAVAGEAGVPFFFCSG-SEFDEMFVGVGAARV--RNLFAAAKEHAP 224 >SB_28183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 35.5 bits (78), Expect = 0.061 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = -3 Query: 98 SKMDPRPPNSCSPGDPLVLE 39 S PR NSCSPGDPLVLE Sbjct: 12 SNQRPRESNSCSPGDPLVLE 31 >SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 35.1 bits (77), Expect = 0.080 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 83 RPPNSCSPGDPLVLE 39 RP NSCSPGDPLVLE Sbjct: 16 RPSNSCSPGDPLVLE 30 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 35.1 bits (77), Expect = 0.080 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -3 Query: 101 LSKMDPRPPNSCSPGDPLVLE 39 LS ++P NSCSPGDPLVLE Sbjct: 49 LSPLEPILSNSCSPGDPLVLE 69 >SB_45949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 35.1 bits (77), Expect = 0.080 Identities = 14/17 (82%), Positives = 14/17 (82%) Frame = -3 Query: 89 DPRPPNSCSPGDPLVLE 39 DP NSCSPGDPLVLE Sbjct: 23 DPNTSNSCSPGDPLVLE 39 >SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -3 Query: 86 PRPPNSCSPGDPLVLE 39 PR NSCSPGDPLVLE Sbjct: 8 PRASNSCSPGDPLVLE 23 >SB_39278| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -3 Query: 98 SKMDPRPPNSCSPGDPLVLE 39 S ++ P NSCSPGDPLVLE Sbjct: 4 SPLESYPSNSCSPGDPLVLE 23 >SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 92 MDPRPPNSCSPGDPLVLE 39 +DP NSCSPGDPLVLE Sbjct: 41 VDPARSNSCSPGDPLVLE 58 >SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = -3 Query: 92 MDPRPPNSCSPGDPLVLE 39 M PR NSCSPGDPLVLE Sbjct: 55 MLPRRSNSCSPGDPLVLE 72 >SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) Length = 365 Score = 34.3 bits (75), Expect = 0.14 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -3 Query: 101 LSKMDPRPPNSCSPGDPLVLE 39 L K+ + NSCSPGDPLVLE Sbjct: 234 LDKLKKKTSNSCSPGDPLVLE 254 >SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) Length = 210 Score = 34.3 bits (75), Expect = 0.14 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -3 Query: 95 KMDPRPPNSCSPGDPLVLE 39 K +P NSCSPGDPLVLE Sbjct: 81 KSEPLSSNSCSPGDPLVLE 99 >SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) Length = 221 Score = 34.3 bits (75), Expect = 0.14 Identities = 15/18 (83%), Positives = 16/18 (88%), Gaps = 1/18 (5%) Frame = -3 Query: 89 DPRPP-NSCSPGDPLVLE 39 D +PP NSCSPGDPLVLE Sbjct: 93 DAQPPSNSCSPGDPLVLE 110 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -3 Query: 101 LSKMDPRPPNSCSPGDPLVLE 39 +S + P NSCSPGDPLVLE Sbjct: 155 VSALPPHLSNSCSPGDPLVLE 175 >SB_35112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 33.9 bits (74), Expect = 0.19 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -3 Query: 83 RPPNSCSPGDPLVLE 39 +P NSCSPGDPLVLE Sbjct: 18 KPSNSCSPGDPLVLE 32 >SB_34686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 33.9 bits (74), Expect = 0.19 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -3 Query: 83 RPPNSCSPGDPLVLE 39 +P NSCSPGDPLVLE Sbjct: 8 KPSNSCSPGDPLVLE 22 >SB_32003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/17 (82%), Positives = 14/17 (82%) Frame = -3 Query: 89 DPRPPNSCSPGDPLVLE 39 D R NSCSPGDPLVLE Sbjct: 9 DDRTSNSCSPGDPLVLE 25 >SB_21711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 33.9 bits (74), Expect = 0.19 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -3 Query: 83 RPPNSCSPGDPLVLE 39 +P NSCSPGDPLVLE Sbjct: 44 KPSNSCSPGDPLVLE 58 >SB_5903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 33.9 bits (74), Expect = 0.19 Identities = 18/41 (43%), Positives = 25/41 (60%) Frame = +2 Query: 503 LYLHKILPNKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEI 625 L L K LP + D V M V++ P Y +GGLD+QI+E+ Sbjct: 127 LILEK-LPAEYDSRVKAMEVDERPTEQYSDIGGLDQQIQEM 166 >SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -3 Query: 95 KMDPRPPNSCSPGDPLVLE 39 K+ R NSCSPGDPLVLE Sbjct: 2 KLSYRTSNSCSPGDPLVLE 20 >SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/20 (75%), Positives = 17/20 (85%), Gaps = 2/20 (10%) Frame = -3 Query: 92 MDPRPP--NSCSPGDPLVLE 39 ++PR P NSCSPGDPLVLE Sbjct: 34 INPRKPPSNSCSPGDPLVLE 53 >SB_3115| Best HMM Match : AAA (HMM E-Value=0) Length = 913 Score = 33.5 bits (73), Expect = 0.24 Identities = 18/64 (28%), Positives = 32/64 (50%) Frame = +2 Query: 584 YEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPSGPWKDIISSCCRSPH 763 ++ V G+ + E+ E ++ +K + LG PKG LL GP G K +++ + Sbjct: 124 FKDVAGMQEAKMEVMEFVDY-LKSAGRYTQLGAKIPKGALLVGPPGTGKTLLAKAVATEA 182 Query: 764 EVYF 775 +V F Sbjct: 183 DVPF 186 Score = 31.5 bits (68), Expect = 0.99 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = +3 Query: 675 LGLRNQKESYCMGLPGPGKTLLARAVAHHMRCTFI 779 LG + K + +G PG GKTLLA+AVA F+ Sbjct: 153 LGAKIPKGALLVGPPGTGKTLLAKAVATEADVPFL 187 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 80 PPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 183 PSNSCSPGDPLVLE 196 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 80 PPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 17 PSNSCSPGDPLVLE 30 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 80 PPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 26 PSNSCSPGDPLVLE 39 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 80 PPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 20 PSNSCSPGDPLVLE 33 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 80 PPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 63 PSNSCSPGDPLVLE 76 >SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) Length = 166 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 80 PPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 42 PSNSCSPGDPLVLE 55 >SB_30021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 80 PPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 54 PSNSCSPGDPLVLE 67 >SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 80 PPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 19 PSNSCSPGDPLVLE 32 >SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 80 PPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 8 PSNSCSPGDPLVLE 21 >SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 80 PPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 56 PSNSCSPGDPLVLE 69 >SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) Length = 280 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 80 PPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 156 PSNSCSPGDPLVLE 169 >SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 80 PPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 20 PSNSCSPGDPLVLE 33 >SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) Length = 593 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 80 PPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 136 PSNSCSPGDPLVLE 149 >SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) Length = 129 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 80 PPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 5 PSNSCSPGDPLVLE 18 >SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 80 PPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 19 PSNSCSPGDPLVLE 32 >SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 80 PPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 28 PSNSCSPGDPLVLE 41 >SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 80 PPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 22 PSNSCSPGDPLVLE 35 >SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 80 PPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 7 PSNSCSPGDPLVLE 20 >SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 33.1 bits (72), Expect = 0.32 Identities = 14/19 (73%), Positives = 14/19 (73%) Frame = -3 Query: 95 KMDPRPPNSCSPGDPLVLE 39 K R NSCSPGDPLVLE Sbjct: 47 KSSSRASNSCSPGDPLVLE 65 >SB_51469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 80 PPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 14 PSNSCSPGDPLVLE 27 >SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 80 PPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 66 PSNSCSPGDPLVLE 79 >SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 80 PPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 55 PSNSCSPGDPLVLE 68 >SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 235 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 80 PPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 111 PSNSCSPGDPLVLE 124 >SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 80 PPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 8 PSNSCSPGDPLVLE 21 >SB_46663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 80 PPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 44 PSNSCSPGDPLVLE 57 >SB_44783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 80 PPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 7 PSNSCSPGDPLVLE 20 >SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -3 Query: 86 PRPPNSCSPGDPLVLE 39 P+ NSCSPGDPLVLE Sbjct: 14 PKRSNSCSPGDPLVLE 29 >SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -3 Query: 86 PRPPNSCSPGDPLVLE 39 P+ NSCSPGDPLVLE Sbjct: 12 PQKSNSCSPGDPLVLE 27 >SB_40947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 80 PPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 35 PSNSCSPGDPLVLE 48 >SB_39848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 80 PPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 14 PSNSCSPGDPLVLE 27 >SB_38869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 80 PPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 14 PSNSCSPGDPLVLE 27 >SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 80 PPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 46 PSNSCSPGDPLVLE 59 >SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 80 PPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 13 PSNSCSPGDPLVLE 26 >SB_32543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 80 PPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 75 PSNSCSPGDPLVLE 88 >SB_22547| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 80 PPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 7 PSNSCSPGDPLVLE 20 >SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 80 PPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 72 PSNSCSPGDPLVLE 85 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 80 PPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 29 PSNSCSPGDPLVLE 42 >SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 80 PPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 23 PSNSCSPGDPLVLE 36 >SB_11000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -3 Query: 86 PRPPNSCSPGDPLVLE 39 P+ NSCSPGDPLVLE Sbjct: 5 PQASNSCSPGDPLVLE 20 >SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) Length = 781 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 80 PPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 515 PSNSCSPGDPLVLE 528 >SB_6274| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 80 PPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 3 PSNSCSPGDPLVLE 16 >SB_3084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 80 PPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 14 PSNSCSPGDPLVLE 27 >SB_876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 80 PPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 19 PSNSCSPGDPLVLE 32 >SB_343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 80 PPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 71 PSNSCSPGDPLVLE 84 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 32.7 bits (71), Expect = 0.43 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = -3 Query: 98 SKMDPRPPNSCSPGDPLVLE 39 +K D NSCSPGDPLVLE Sbjct: 18 AKNDALSSNSCSPGDPLVLE 37 >SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 32.7 bits (71), Expect = 0.43 Identities = 15/20 (75%), Positives = 16/20 (80%), Gaps = 3/20 (15%) Frame = -3 Query: 89 DPRPP---NSCSPGDPLVLE 39 DP+ P NSCSPGDPLVLE Sbjct: 11 DPKRPHRSNSCSPGDPLVLE 30 >SB_21311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 32.7 bits (71), Expect = 0.43 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -3 Query: 101 LSKMDPRPPNSCSPGDPLVLE 39 L + R NSCSPGDPLVLE Sbjct: 12 LDHTERRASNSCSPGDPLVLE 32 >SB_21097| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 32.7 bits (71), Expect = 0.43 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -3 Query: 86 PRPPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 62 PETSNSCSPGDPLVLE 77 >SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 32.7 bits (71), Expect = 0.43 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -3 Query: 89 DPRPPNSCSPGDPLVLE 39 +P NSCSPGDPLVLE Sbjct: 5 EPLASNSCSPGDPLVLE 21 >SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 32.7 bits (71), Expect = 0.43 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = -3 Query: 95 KMDPRPPNSCSPGDPLVLE 39 ++ P NSCSPGDPLVLE Sbjct: 5 EVSPEISNSCSPGDPLVLE 23 >SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 32.3 bits (70), Expect = 0.56 Identities = 16/23 (69%), Positives = 17/23 (73%), Gaps = 2/23 (8%) Frame = -3 Query: 101 LSKMDPR--PPNSCSPGDPLVLE 39 L+K D R NSCSPGDPLVLE Sbjct: 3 LNKRDERLSTSNSCSPGDPLVLE 25 >SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 32.3 bits (70), Expect = 0.56 Identities = 14/19 (73%), Positives = 15/19 (78%), Gaps = 1/19 (5%) Frame = -3 Query: 92 MDPRP-PNSCSPGDPLVLE 39 + P P NSCSPGDPLVLE Sbjct: 64 LQPHPRSNSCSPGDPLVLE 82 >SB_55690| Best HMM Match : AAA (HMM E-Value=0) Length = 1031 Score = 32.3 bits (70), Expect = 0.56 Identities = 18/53 (33%), Positives = 27/53 (50%) Frame = +2 Query: 584 YEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPSGPWKDIIS 742 +E VGGL ++E + P K LF + G+LLYGP G K +++ Sbjct: 666 WENVGGLGPVKGVLQETLLWPSKFAGLFAKCPLRLRGGLLLYGPPGTGKTLLA 718 Score = 30.7 bits (66), Expect = 1.7 Identities = 27/72 (37%), Positives = 33/72 (45%), Gaps = 2/72 (2%) Frame = +3 Query: 672 PLGLRNQKESYCMGLPGPGKTLLARAVAHHMRCTF--IRGSXIRNWYQKFIGRKAAKMGA 845 PL LR Y G PG GKTLLA VA F I+G + K+IG A++ Sbjct: 697 PLRLRGGLLLY--GPPGTGKTLLAGVVAKECGLNFISIKGPEL---LSKYIG--ASEQAV 749 Query: 846 ERLFVMGQRNKP 881 +F Q KP Sbjct: 750 RDMFTRAQSAKP 761 >SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 32.3 bits (70), Expect = 0.56 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -3 Query: 92 MDPRPPNSCSPGDPLVLE 39 +D + NSCSPGDPLVLE Sbjct: 17 IDHKGSNSCSPGDPLVLE 34 >SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 32.3 bits (70), Expect = 0.56 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = -3 Query: 95 KMDPRPPNSCSPGDPLVLE 39 ++ P NSCSPGDPLVLE Sbjct: 5 RIPPGVSNSCSPGDPLVLE 23 >SB_34430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 32.3 bits (70), Expect = 0.56 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -3 Query: 122 ITNVRF*LSKMDPRPPNSCSPGDPLVLE 39 I N+ F S D NSCSPGDPLVLE Sbjct: 9 IENISFPKSA-DVNGSNSCSPGDPLVLE 35 >SB_23253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 32.3 bits (70), Expect = 0.56 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -3 Query: 101 LSKMDPRPPNSCSPGDPLVLE 39 L+K + NSCSPGDPLVLE Sbjct: 32 LNKTAIKASNSCSPGDPLVLE 52 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 32.3 bits (70), Expect = 0.56 Identities = 16/29 (55%), Positives = 19/29 (65%), Gaps = 3/29 (10%) Frame = -3 Query: 116 NVRF*LSKMDPRP---PNSCSPGDPLVLE 39 N+R + + RP NSCSPGDPLVLE Sbjct: 12 NIRISVLALKSRPMLVSNSCSPGDPLVLE 40 >SB_17566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -3 Query: 101 LSKMDPRPPNSCSPGDPLVLE 39 LS P NSCSPGDPLVLE Sbjct: 2 LSVDGPYGSNSCSPGDPLVLE 22 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 31.9 bits (69), Expect = 0.75 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 83 RPPNSCSPGDPLVLE 39 R NSCSPGDPLVLE Sbjct: 22 RASNSCSPGDPLVLE 36 >SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 31.9 bits (69), Expect = 0.75 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 83 RPPNSCSPGDPLVLE 39 R NSCSPGDPLVLE Sbjct: 21 RESNSCSPGDPLVLE 35 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 31.9 bits (69), Expect = 0.75 Identities = 15/26 (57%), Positives = 17/26 (65%) Frame = -3 Query: 116 NVRF*LSKMDPRPPNSCSPGDPLVLE 39 N++F R NSCSPGDPLVLE Sbjct: 172 NLQFSWIDWTRRVSNSCSPGDPLVLE 197 >SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 31.9 bits (69), Expect = 0.75 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 83 RPPNSCSPGDPLVLE 39 R NSCSPGDPLVLE Sbjct: 21 RKSNSCSPGDPLVLE 35 >SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 31.9 bits (69), Expect = 0.75 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 83 RPPNSCSPGDPLVLE 39 R NSCSPGDPLVLE Sbjct: 76 RESNSCSPGDPLVLE 90 >SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 31.9 bits (69), Expect = 0.75 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 83 RPPNSCSPGDPLVLE 39 R NSCSPGDPLVLE Sbjct: 101 RTSNSCSPGDPLVLE 115 >SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 31.9 bits (69), Expect = 0.75 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 83 RPPNSCSPGDPLVLE 39 R NSCSPGDPLVLE Sbjct: 23 RQSNSCSPGDPLVLE 37 >SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 31.9 bits (69), Expect = 0.75 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -3 Query: 101 LSKMDPRPPNSCSPGDPLVLE 39 + + P NSCSPGDPLVLE Sbjct: 4 IREAQPVTSNSCSPGDPLVLE 24 >SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 31.9 bits (69), Expect = 0.75 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -3 Query: 101 LSKMDPRPPNSCSPGDPLVLE 39 +S R NSCSPGDPLVLE Sbjct: 1 MSPEKSRRSNSCSPGDPLVLE 21 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 31.9 bits (69), Expect = 0.75 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -3 Query: 92 MDPRPPNSCSPGDPLVLE 39 + P NSCSPGDPLVLE Sbjct: 1189 LKPFASNSCSPGDPLVLE 1206 >SB_47774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 31.9 bits (69), Expect = 0.75 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 83 RPPNSCSPGDPLVLE 39 R NSCSPGDPLVLE Sbjct: 18 RESNSCSPGDPLVLE 32 >SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 31.9 bits (69), Expect = 0.75 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 83 RPPNSCSPGDPLVLE 39 R NSCSPGDPLVLE Sbjct: 13 RASNSCSPGDPLVLE 27 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 31.9 bits (69), Expect = 0.75 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -3 Query: 86 PRPPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 10 PMVSNSCSPGDPLVLE 25 >SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) Length = 1098 Score = 31.9 bits (69), Expect = 0.75 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = -3 Query: 110 RF*LSKMDPRPPNSCSPGDPLVLE 39 RF +S+ NSCSPGDPLVLE Sbjct: 964 RFTVSRRKGWISNSCSPGDPLVLE 987 >SB_36996| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 31.9 bits (69), Expect = 0.75 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 83 RPPNSCSPGDPLVLE 39 R NSCSPGDPLVLE Sbjct: 2 RKSNSCSPGDPLVLE 16 >SB_36738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 31.9 bits (69), Expect = 0.75 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 83 RPPNSCSPGDPLVLE 39 R NSCSPGDPLVLE Sbjct: 5 RSSNSCSPGDPLVLE 19 >SB_36586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 31.9 bits (69), Expect = 0.75 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 83 RPPNSCSPGDPLVLE 39 R NSCSPGDPLVLE Sbjct: 10 RTSNSCSPGDPLVLE 24 >SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 31.9 bits (69), Expect = 0.75 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -3 Query: 98 SKMDPRPPNSCSPGDPLVLE 39 + + P NSCSPGDPLVLE Sbjct: 11 ANIGPITSNSCSPGDPLVLE 30 >SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 31.9 bits (69), Expect = 0.75 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -3 Query: 86 PRPPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 19 PLASNSCSPGDPLVLE 34 >SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 31.9 bits (69), Expect = 0.75 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 83 RPPNSCSPGDPLVLE 39 R NSCSPGDPLVLE Sbjct: 9 RASNSCSPGDPLVLE 23 >SB_7708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 31.9 bits (69), Expect = 0.75 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 83 RPPNSCSPGDPLVLE 39 R NSCSPGDPLVLE Sbjct: 4 RASNSCSPGDPLVLE 18 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 31.5 bits (68), Expect = 0.99 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -3 Query: 92 MDPRPPNSCSPGDPLVLE 39 M+ + NSCSPGDPLVLE Sbjct: 1 MNAQISNSCSPGDPLVLE 18 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 31.5 bits (68), Expect = 0.99 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 83 RPPNSCSPGDPLVLE 39 R NSCSPGDPLVLE Sbjct: 380 RRSNSCSPGDPLVLE 394 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 31.5 bits (68), Expect = 0.99 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -3 Query: 101 LSKMDPRPPNSCSPGDPLVLE 39 LS + NSCSPGDPLVLE Sbjct: 14 LSYLPINESNSCSPGDPLVLE 34 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 31.5 bits (68), Expect = 0.99 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 83 RPPNSCSPGDPLVLE 39 R NSCSPGDPLVLE Sbjct: 6 RVSNSCSPGDPLVLE 20 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 31.5 bits (68), Expect = 0.99 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -3 Query: 86 PRPPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 2 PLVSNSCSPGDPLVLE 17 >SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 31.5 bits (68), Expect = 0.99 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 83 RPPNSCSPGDPLVLE 39 R NSCSPGDPLVLE Sbjct: 39 RGSNSCSPGDPLVLE 53 >SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 31.5 bits (68), Expect = 0.99 Identities = 12/21 (57%), Positives = 17/21 (80%) Frame = -3 Query: 101 LSKMDPRPPNSCSPGDPLVLE 39 +++++ NSCSPGDPLVLE Sbjct: 7 ITEINSTASNSCSPGDPLVLE 27 >SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 31.5 bits (68), Expect = 0.99 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -3 Query: 86 PRPPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 44 PGGSNSCSPGDPLVLE 59 >SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/22 (68%), Positives = 17/22 (77%), Gaps = 2/22 (9%) Frame = -3 Query: 98 SKMDPRPP--NSCSPGDPLVLE 39 S++ R P NSCSPGDPLVLE Sbjct: 8 SRVGVRTPTSNSCSPGDPLVLE 29 >SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 31.5 bits (68), Expect = 0.99 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 83 RPPNSCSPGDPLVLE 39 R NSCSPGDPLVLE Sbjct: 2 RRSNSCSPGDPLVLE 16 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 31.5 bits (68), Expect = 0.99 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 83 RPPNSCSPGDPLVLE 39 R NSCSPGDPLVLE Sbjct: 39 RVSNSCSPGDPLVLE 53 >SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 31.5 bits (68), Expect = 0.99 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -3 Query: 86 PRPPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 4 PFSSNSCSPGDPLVLE 19 >SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 31.5 bits (68), Expect = 0.99 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = -3 Query: 89 DPRPPNSCSPGDPLVLE 39 D NSCSPGDPLVLE Sbjct: 26 DHNQSNSCSPGDPLVLE 42 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.99 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 83 RPPNSCSPGDPLVLE 39 R NSCSPGDPLVLE Sbjct: 31 RVSNSCSPGDPLVLE 45 >SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 31.5 bits (68), Expect = 0.99 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 83 RPPNSCSPGDPLVLE 39 R NSCSPGDPLVLE Sbjct: 5 RRSNSCSPGDPLVLE 19 >SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 31.5 bits (68), Expect = 0.99 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 83 RPPNSCSPGDPLVLE 39 R NSCSPGDPLVLE Sbjct: 24 RRSNSCSPGDPLVLE 38 >SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 31.5 bits (68), Expect = 0.99 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = -3 Query: 95 KMDPRPPNSCSPGDPLVLE 39 +M+ NSCSPGDPLVLE Sbjct: 13 QMEVLASNSCSPGDPLVLE 31 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 31.5 bits (68), Expect = 0.99 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -3 Query: 86 PRPPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 57 PPVSNSCSPGDPLVLE 72 >SB_40987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 31.5 bits (68), Expect = 0.99 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -3 Query: 95 KMDPRPPNSCSPGDPLVLE 39 K + NSCSPGDPLVLE Sbjct: 47 KTEDTTSNSCSPGDPLVLE 65 >SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 31.5 bits (68), Expect = 0.99 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 83 RPPNSCSPGDPLVLE 39 R NSCSPGDPLVLE Sbjct: 3 RVSNSCSPGDPLVLE 17 >SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 31.5 bits (68), Expect = 0.99 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 83 RPPNSCSPGDPLVLE 39 R NSCSPGDPLVLE Sbjct: 59 RRSNSCSPGDPLVLE 73 >SB_29704| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 31.5 bits (68), Expect = 0.99 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -3 Query: 101 LSKMDPRPPNSCSPGDPLVLE 39 +S + NSCSPGDPLVLE Sbjct: 15 VSNQTKQSSNSCSPGDPLVLE 35 >SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 31.5 bits (68), Expect = 0.99 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -3 Query: 86 PRPPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 35 PALSNSCSPGDPLVLE 50 >SB_22214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 31.5 bits (68), Expect = 0.99 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 83 RPPNSCSPGDPLVLE 39 R NSCSPGDPLVLE Sbjct: 25 RGSNSCSPGDPLVLE 39 >SB_16765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 31.5 bits (68), Expect = 0.99 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 83 RPPNSCSPGDPLVLE 39 R NSCSPGDPLVLE Sbjct: 10 RGSNSCSPGDPLVLE 24 >SB_13994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 31.5 bits (68), Expect = 0.99 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 83 RPPNSCSPGDPLVLE 39 R NSCSPGDPLVLE Sbjct: 2 RRSNSCSPGDPLVLE 16 >SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 31.5 bits (68), Expect = 0.99 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 83 RPPNSCSPGDPLVLE 39 R NSCSPGDPLVLE Sbjct: 7 RRSNSCSPGDPLVLE 21 >SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 31.5 bits (68), Expect = 0.99 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 83 RPPNSCSPGDPLVLE 39 R NSCSPGDPLVLE Sbjct: 8 RVSNSCSPGDPLVLE 22 >SB_5222| Best HMM Match : Ras (HMM E-Value=2.9e-09) Length = 181 Score = 31.5 bits (68), Expect = 0.99 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 83 RPPNSCSPGDPLVLE 39 R NSCSPGDPLVLE Sbjct: 70 RGSNSCSPGDPLVLE 84 >SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 31.5 bits (68), Expect = 0.99 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -3 Query: 86 PRPPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 43 PTISNSCSPGDPLVLE 58 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -3 Query: 101 LSKMDPRPPNSCSPGDPLVLE 39 L+ + + NSCSPGDPLVLE Sbjct: 3 LNNLCYKTSNSCSPGDPLVLE 23 >SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 83 RPPNSCSPGDPLVLE 39 R NSCSPGDPLVLE Sbjct: 23 RLSNSCSPGDPLVLE 37 >SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1010 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -3 Query: 98 SKMDPRPPNSCSPGDPLVLE 39 +K NSCSPGDPLVLE Sbjct: 77 AKRQQMASNSCSPGDPLVLE 96 >SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -3 Query: 92 MDPRPPNSCSPGDPLVLE 39 + + NSCSPGDPLVLE Sbjct: 17 LQEKKSNSCSPGDPLVLE 34 >SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = -3 Query: 89 DPRPPNSCSPGDPLVLE 39 D NSCSPGDPLVLE Sbjct: 4 DDEISNSCSPGDPLVLE 20 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -3 Query: 86 PRPPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 53 PLLSNSCSPGDPLVLE 68 >SB_46791| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -3 Query: 86 PRPPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 23 PFGSNSCSPGDPLVLE 38 >SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 83 RPPNSCSPGDPLVLE 39 R NSCSPGDPLVLE Sbjct: 31 RISNSCSPGDPLVLE 45 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -3 Query: 86 PRPPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 23 PLISNSCSPGDPLVLE 38 >SB_40734| Best HMM Match : DUF765 (HMM E-Value=0.42) Length = 129 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -3 Query: 92 MDPRPPNSCSPGDPLVLE 39 M NSCSPGDPLVLE Sbjct: 1 MQSSTSNSCSPGDPLVLE 18 >SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -3 Query: 86 PRPPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 14 PFRSNSCSPGDPLVLE 29 >SB_20081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -3 Query: 89 DPRPPNSCSPGDPLVLE 39 + + NSCSPGDPLVLE Sbjct: 46 EKKTSNSCSPGDPLVLE 62 >SB_16436| Best HMM Match : DUF765 (HMM E-Value=9.2) Length = 129 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%), Gaps = 1/19 (5%) Frame = -3 Query: 92 MDPRPP-NSCSPGDPLVLE 39 M RP NSCSPGDPLVLE Sbjct: 1 MFARPTSNSCSPGDPLVLE 19 >SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -3 Query: 86 PRPPNSCSPGDPLVLE 39 P NSCSPGDPLVLE Sbjct: 52 PFRSNSCSPGDPLVLE 67 >SB_6342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -3 Query: 98 SKMDPRPPNSCSPGDPLVLE 39 S+ + NSCSPGDPLVLE Sbjct: 23 SRCSCQSSNSCSPGDPLVLE 42 >SB_5062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 83 RPPNSCSPGDPLVLE 39 R NSCSPGDPLVLE Sbjct: 13 RLSNSCSPGDPLVLE 27 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 13 NSCSPGDPLVLE 24 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 11 NSCSPGDPLVLE 22 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 36 NSCSPGDPLVLE 47 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 27 NSCSPGDPLVLE 38 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 4 NSCSPGDPLVLE 15 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 19 NSCSPGDPLVLE 30 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 80 NSCSPGDPLVLE 91 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 16 NSCSPGDPLVLE 27 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 350 NSCSPGDPLVLE 361 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 8 NSCSPGDPLVLE 19 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 103 NSCSPGDPLVLE 114 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 32 NSCSPGDPLVLE 43 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 8 NSCSPGDPLVLE 19 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 36 NSCSPGDPLVLE 47 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 5 NSCSPGDPLVLE 16 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 83 NSCSPGDPLVLE 94 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 3 NSCSPGDPLVLE 14 >SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2070 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 517 NSCSPGDPLVLE 528 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 15 NSCSPGDPLVLE 26 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 32 NSCSPGDPLVLE 43 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 3 NSCSPGDPLVLE 14 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 23 NSCSPGDPLVLE 34 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 20 NSCSPGDPLVLE 31 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 4 NSCSPGDPLVLE 15 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 18 NSCSPGDPLVLE 29 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 8 NSCSPGDPLVLE 19 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 55 NSCSPGDPLVLE 66 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 5 NSCSPGDPLVLE 16 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 263 NSCSPGDPLVLE 274 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 26 NSCSPGDPLVLE 37 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 20 NSCSPGDPLVLE 31 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 12 NSCSPGDPLVLE 23 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 12 NSCSPGDPLVLE 23 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 12 NSCSPGDPLVLE 23 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 20 NSCSPGDPLVLE 31 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 14 NSCSPGDPLVLE 25 >SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) Length = 143 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 21 NSCSPGDPLVLE 32 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 18 NSCSPGDPLVLE 29 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 36 NSCSPGDPLVLE 47 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 19 NSCSPGDPLVLE 30 >SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 9 NSCSPGDPLVLE 20 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 18 NSCSPGDPLVLE 29 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 17 NSCSPGDPLVLE 28 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 6 NSCSPGDPLVLE 17 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 5 NSCSPGDPLVLE 16 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 12 NSCSPGDPLVLE 23 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 49 NSCSPGDPLVLE 60 >SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 14 NSCSPGDPLVLE 25 >SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 114 NSCSPGDPLVLE 125 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 894 NSCSPGDPLVLE 905 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 15 NSCSPGDPLVLE 26 >SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 15 NSCSPGDPLVLE 26 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 95 NSCSPGDPLVLE 106 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 66 NSCSPGDPLVLE 77 >SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 16 NSCSPGDPLVLE 27 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 877 NSCSPGDPLVLE 888 >SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) Length = 130 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 8 NSCSPGDPLVLE 19 >SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 12 NSCSPGDPLVLE 23 >SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 64 NSCSPGDPLVLE 75 >SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 21 NSCSPGDPLVLE 32 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 65 NSCSPGDPLVLE 76 >SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 44 NSCSPGDPLVLE 55 >SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 27 NSCSPGDPLVLE 38 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 40 NSCSPGDPLVLE 51 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 16 NSCSPGDPLVLE 27 >SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 22 NSCSPGDPLVLE 33 >SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 25 NSCSPGDPLVLE 36 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 4 NSCSPGDPLVLE 15 >SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 41 NSCSPGDPLVLE 52 >SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) Length = 265 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 143 NSCSPGDPLVLE 154 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 484 NSCSPGDPLVLE 495 >SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 3 NSCSPGDPLVLE 14 >SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 36 NSCSPGDPLVLE 47 >SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 82 NSCSPGDPLVLE 93 >SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 37 NSCSPGDPLVLE 48 >SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 62 NSCSPGDPLVLE 73 >SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 25 NSCSPGDPLVLE 36 >SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 5 NSCSPGDPLVLE 16 >SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 5 NSCSPGDPLVLE 16 >SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 55 NSCSPGDPLVLE 66 >SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 74 NSCSPGDPLVLE 39 NSCSPGDPLVLE Sbjct: 8 NSCSPGDPLVLE 19 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,629,424 Number of Sequences: 59808 Number of extensions: 502246 Number of successful extensions: 2825 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2685 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2811 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2657535823 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -