BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0124 (919 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 23 9.8 AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. 23 9.8 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 23.4 bits (48), Expect = 9.8 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +2 Query: 590 MVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLY 709 +VGG +++ ++E K +L + L PKG L++ Sbjct: 390 IVGGACADVEQTIHLVEKFKKRKKLEEILNGGNPKGTLVF 429 >AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. Length = 437 Score = 23.4 bits (48), Expect = 9.8 Identities = 10/21 (47%), Positives = 12/21 (57%), Gaps = 1/21 (4%) Frame = -1 Query: 691 WLR-NPKGIKQLWVLHRQLNH 632 WL N G LW+ +RQ NH Sbjct: 228 WLEINVTGAVNLWLKNRQANH 248 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 855,528 Number of Sequences: 2352 Number of extensions: 16857 Number of successful extensions: 22 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 99641691 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -