BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0120 (719 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15549| Best HMM Match : ADH_zinc_N (HMM E-Value=9.4e-13) 85 4e-17 SB_27978| Best HMM Match : HycH (HMM E-Value=0.12) 53 3e-07 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_1405| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 47 1e-05 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_13994| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_11993| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_47774| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_30677| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_21311| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_37747| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_16924| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_5222| Best HMM Match : Ras (HMM E-Value=2.9e-09) 46 3e-05 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 46 4e-05 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_36996| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_34552| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_31086| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_23941| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_3006| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_52165| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_51469| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_41531| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_36738| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_24720| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_24360| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_20081| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_7708| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_34798| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_28183| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_20823| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_18474| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_17014| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_6419| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_5303| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_741| Best HMM Match : Agenet (HMM E-Value=7.4) 44 9e-05 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_37222| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_36586| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_34686| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_34241| Best HMM Match : RuvA_C (HMM E-Value=1.5) 44 9e-05 SB_33797| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_32003| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) 44 9e-05 SB_30190| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_23253| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_18776| Best HMM Match : DUF765 (HMM E-Value=4) 44 9e-05 SB_11970| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_132| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 44 1e-04 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 44 1e-04 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46157| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_42272| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_41735| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_22502| Best HMM Match : FtsL (HMM E-Value=0.0086) 44 1e-04 SB_22214| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_19132| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_18165| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_17626| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_16765| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_15537| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_5062| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1736| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1318| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 44 2e-04 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 44 2e-04 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 44 2e-04 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_47610| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_43717| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_39410| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_32594| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_30117| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_29704| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_28661| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_22083| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_16436| Best HMM Match : DUF765 (HMM E-Value=9.2) 44 2e-04 SB_10667| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_4378| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_4147| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_3957| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 44 2e-04 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 43 2e-04 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 43 2e-04 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 43 2e-04 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 43 2e-04 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 43 2e-04 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 43 2e-04 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 43 2e-04 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 43 2e-04 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 43 2e-04 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 43 2e-04 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 43 2e-04 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 43 2e-04 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 43 2e-04 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 43 2e-04 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 43 2e-04 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 43 2e-04 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 43 2e-04 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 43 2e-04 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 43 2e-04 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 43 2e-04 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 43 2e-04 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 43 2e-04 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 43 2e-04 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 43 2e-04 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 43 2e-04 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 43 2e-04 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 43 2e-04 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 43 2e-04 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 43 2e-04 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 43 2e-04 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 43 2e-04 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 43 2e-04 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 43 2e-04 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 43 2e-04 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_54347| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 43 2e-04 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_53321| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52633| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_51470| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_51374| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_50614| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) 43 2e-04 SB_49267| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_49082| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_48925| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_48900| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_48334| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_47996| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_47580| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_47576| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_47430| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_47128| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_47127| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_46791| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_46688| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_46663| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_46485| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) 43 2e-04 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_45961| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_45949| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_45308| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_44850| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_44783| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_44611| Best HMM Match : DUF765 (HMM E-Value=2.6) 43 2e-04 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 43 2e-04 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 43 2e-04 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_43349| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_43046| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 43 2e-04 SB_42545| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_42492| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_42248| Best HMM Match : Keratin_B2 (HMM E-Value=4.4) 43 2e-04 SB_42077| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_41224| Best HMM Match : DUF765 (HMM E-Value=3.5) 43 2e-04 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_40987| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_40947| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_40885| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_40734| Best HMM Match : DUF765 (HMM E-Value=0.42) 43 2e-04 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_39977| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_39848| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_39773| Best HMM Match : DUF765 (HMM E-Value=4.1) 43 2e-04 >SB_15549| Best HMM Match : ADH_zinc_N (HMM E-Value=9.4e-13) Length = 562 Score = 85.4 bits (202), Expect = 4e-17 Identities = 37/83 (44%), Positives = 54/83 (65%) Frame = +3 Query: 261 KDETPPPKEMRAVVLTGFGGLKTVKILKKPEPTVGEGEVLIRVKACGLNFQDLIVRQGAI 440 K+ P MR+VVLTG GG +K+ K P +G+V+++V ACG+ F DL+ RQG Sbjct: 30 KEVQPELHSMRSVVLTGHGGNNKIKVEKYARPKPMQGQVVVKVHACGVTFADLLQRQGHF 89 Query: 441 DSPPKTPFILGFECAGEIEQVGE 509 PK P++ GFEC+G +E++GE Sbjct: 90 PLAPKPPYVCGFECSGVVEELGE 112 Score = 35.1 bits (77), Expect = 0.058 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +2 Query: 512 VTNFKVGDQVVALPEYRAWAELVSVPAQYVYALPEGMS 625 VT VG +V+ L Y W E V A+ Y +PE M+ Sbjct: 114 VTGIDVGARVICLAPYGMWTEYACVDAKMCYVMPEAMT 151 >SB_27978| Best HMM Match : HycH (HMM E-Value=0.12) Length = 316 Score = 52.8 bits (121), Expect = 3e-07 Identities = 30/75 (40%), Positives = 44/75 (58%) Frame = +3 Query: 282 KEMRAVVLTGFGGLKTVKILKKPEPTVGEGEVLIRVKACGLNFQDLIVRQGAIDSPPKTP 461 + M+AV+ T GG +++ I P P + E EVLIRV LN D + R+G+ PP Sbjct: 26 ESMKAVLFTP-GGPESMYIGDAPRPKLKETEVLIRVHFTALNRADTLQRKGSYPPPPGES 84 Query: 462 FILGFECAGEIEQVG 506 ILG E +G +E++G Sbjct: 85 EILGLEVSGIVEELG 99 Score = 31.9 bits (69), Expect = 0.54 Identities = 15/39 (38%), Positives = 24/39 (61%) Frame = +2 Query: 521 FKVGDQVVALPEYRAWAELVSVPAQYVYALPEGMSALDA 637 ++ GD+V+AL +AE +V +V +P+GMS DA Sbjct: 106 WRKGDKVMALVPGGGYAEFAAVQESHVMPIPKGMSQSDA 144 >SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 48.8 bits (111), Expect = 4e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -3 Query: 87 RRRPNSCSPGDPLVLERPPPR 25 RRR NSCSPGDPLVLERPPPR Sbjct: 4 RRRSNSCSPGDPLVLERPPPR 24 >SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 446 Score = 48.8 bits (111), Expect = 4e-06 Identities = 31/60 (51%), Positives = 35/60 (58%), Gaps = 3/60 (5%) Frame = -3 Query: 195 GLLRCWSRGGVRTLSHFDDRGRVDL--NE*RSAANEGIRR-RPNSCSPGDPLVLERPPPR 25 GLL+ + V L H + DL NE S + G R R NSCSPGDPLVLERPPPR Sbjct: 282 GLLQI-AMAAVSALKHKNLEHMEDLLSNEKVSGGSYGANRVRSNSCSPGDPLVLERPPPR 340 >SB_1405| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 48.8 bits (111), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = -3 Query: 102 ANEGIRRRPNSCSPGDPLVLERPPPR 25 AN G R NSCSPGDPLVLERPPPR Sbjct: 14 ANNGQFERSNSCSPGDPLVLERPPPR 39 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 48.0 bits (109), Expect = 8e-06 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = -3 Query: 93 GIRRRPNSCSPGDPLVLERPPPR 25 G R R NSCSPGDPLVLERPPPR Sbjct: 6 GARYRSNSCSPGDPLVLERPPPR 28 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 47.6 bits (108), Expect = 1e-05 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = -3 Query: 96 EGIRRRPNSCSPGDPLVLERPPPR 25 EG R NSCSPGDPLVLERPPPR Sbjct: 48 EGFRVASNSCSPGDPLVLERPPPR 71 >SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 47.6 bits (108), Expect = 1e-05 Identities = 20/34 (58%), Positives = 25/34 (73%) Frame = -3 Query: 126 DLNE*RSAANEGIRRRPNSCSPGDPLVLERPPPR 25 +LN+ + + +R NSCSPGDPLVLERPPPR Sbjct: 9 ELNQSTRGDSPIVEKRSNSCSPGDPLVLERPPPR 42 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = -3 Query: 90 IRRRPNSCSPGDPLVLERPPPR 25 + RR NSCSPGDPLVLERPPPR Sbjct: 378 VDRRSNSCSPGDPLVLERPPPR 399 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = -3 Query: 90 IRRRPNSCSPGDPLVLERPPPR 25 +R R NSCSPGDPLVLERPPPR Sbjct: 21 LRSRSNSCSPGDPLVLERPPPR 42 >SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 47.2 bits (107), Expect = 1e-05 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = -3 Query: 105 AANEGIRRRPNSCSPGDPLVLERPPPR 25 +A G R NSCSPGDPLVLERPPPR Sbjct: 206 SAQNGKHLRSNSCSPGDPLVLERPPPR 232 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -3 Query: 102 ANEGIRRRPNSCSPGDPLVLERPPPR 25 A GI NSCSPGDPLVLERPPPR Sbjct: 2 AKTGITTTSNSCSPGDPLVLERPPPR 27 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 46.8 bits (106), Expect = 2e-05 Identities = 28/60 (46%), Positives = 33/60 (55%), Gaps = 6/60 (10%) Frame = -3 Query: 186 RCWSRGGVRTLSHFDDRGRVDLNE*RSAANEGIRRR------PNSCSPGDPLVLERPPPR 25 R W R GV+ LS + R RS + +R + NSCSPGDPLVLERPPPR Sbjct: 79 RDWRRRGVQGLSGKGWKARPLTEMGRSLCRQLVRAKNQKEIISNSCSPGDPLVLERPPPR 138 >SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -3 Query: 87 RRRPNSCSPGDPLVLERPPPR 25 RR NSCSPGDPLVLERPPPR Sbjct: 20 RRESNSCSPGDPLVLERPPPR 40 >SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 84 RRPNSCSPGDPLVLERPPPR 25 RR NSCSPGDPLVLERPPPR Sbjct: 2 RRSNSCSPGDPLVLERPPPR 21 >SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 84 RRPNSCSPGDPLVLERPPPR 25 RR NSCSPGDPLVLERPPPR Sbjct: 7 RRSNSCSPGDPLVLERPPPR 26 >SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 84 RRPNSCSPGDPLVLERPPPR 25 RR NSCSPGDPLVLERPPPR Sbjct: 24 RRSNSCSPGDPLVLERPPPR 43 >SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 84 RRPNSCSPGDPLVLERPPPR 25 RR NSCSPGDPLVLERPPPR Sbjct: 58 RRSNSCSPGDPLVLERPPPR 77 >SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 84 RRPNSCSPGDPLVLERPPPR 25 RR NSCSPGDPLVLERPPPR Sbjct: 59 RRSNSCSPGDPLVLERPPPR 78 >SB_13994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 84 RRPNSCSPGDPLVLERPPPR 25 RR NSCSPGDPLVLERPPPR Sbjct: 2 RRSNSCSPGDPLVLERPPPR 21 >SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -3 Query: 87 RRRPNSCSPGDPLVLERPPPR 25 R R NSCSPGDPLVLERPPPR Sbjct: 29 RERSNSCSPGDPLVLERPPPR 49 >SB_11993| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = -3 Query: 105 AANEGIRRRPNSCSPGDPLVLERPPPR 25 A G R + NSCSPGDPLVLERPPPR Sbjct: 20 APPRGRRAKSNSCSPGDPLVLERPPPR 46 >SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 84 RRPNSCSPGDPLVLERPPPR 25 RR NSCSPGDPLVLERPPPR Sbjct: 7 RRSNSCSPGDPLVLERPPPR 26 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 46.4 bits (105), Expect = 2e-05 Identities = 25/47 (53%), Positives = 29/47 (61%), Gaps = 3/47 (6%) Frame = -3 Query: 156 LSHFDDR---GRVDLNE*RSAANEGIRRRPNSCSPGDPLVLERPPPR 25 + HF D +DL + RS +R NSCSPGDPLVLERPPPR Sbjct: 1 MKHFTDTLISANIDLQKRRS------KRASNSCSPGDPLVLERPPPR 41 >SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 46.4 bits (105), Expect = 2e-05 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -3 Query: 87 RRRPNSCSPGDPLVLERPPPR 25 R R NSCSPGDPLVLERPPPR Sbjct: 27 RSRSNSCSPGDPLVLERPPPR 47 >SB_47774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 46.4 bits (105), Expect = 2e-05 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = -3 Query: 96 EGIRRRPNSCSPGDPLVLERPPPR 25 +G R NSCSPGDPLVLERPPPR Sbjct: 14 QGYIRESNSCSPGDPLVLERPPPR 37 >SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 46.4 bits (105), Expect = 2e-05 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -3 Query: 87 RRRPNSCSPGDPLVLERPPPR 25 R R NSCSPGDPLVLERPPPR Sbjct: 8 RTRSNSCSPGDPLVLERPPPR 28 >SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 46.4 bits (105), Expect = 2e-05 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = -3 Query: 90 IRRRPNSCSPGDPLVLERPPPR 25 I +R NSCSPGDPLVLERPPPR Sbjct: 13 IPKRSNSCSPGDPLVLERPPPR 34 >SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 46.4 bits (105), Expect = 2e-05 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -3 Query: 87 RRRPNSCSPGDPLVLERPPPR 25 ++R NSCSPGDPLVLERPPPR Sbjct: 42 KKRSNSCSPGDPLVLERPPPR 62 >SB_30677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 46.4 bits (105), Expect = 2e-05 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -3 Query: 87 RRRPNSCSPGDPLVLERPPPR 25 ++R NSCSPGDPLVLERPPPR Sbjct: 3 KKRSNSCSPGDPLVLERPPPR 23 >SB_21311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 46.4 bits (105), Expect = 2e-05 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -3 Query: 87 RRRPNSCSPGDPLVLERPPPR 25 RR NSCSPGDPLVLERPPPR Sbjct: 17 RRASNSCSPGDPLVLERPPPR 37 >SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -3 Query: 87 RRRPNSCSPGDPLVLERPPPR 25 R R NSCSPGDPLVLERPPPR Sbjct: 20 RPRSNSCSPGDPLVLERPPPR 40 >SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = -3 Query: 90 IRRRPNSCSPGDPLVLERPPPR 25 I+ R NSCSPGDPLVLERPPPR Sbjct: 13 IKFRSNSCSPGDPLVLERPPPR 34 >SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -3 Query: 99 NEGIRRRPNSCSPGDPLVLERPPPR 25 N+GI+ NSCSPGDPLVLERPPPR Sbjct: 5 NDGIKTS-NSCSPGDPLVLERPPPR 28 >SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -3 Query: 87 RRRPNSCSPGDPLVLERPPPR 25 R R NSCSPGDPLVLERPPPR Sbjct: 15 RPRSNSCSPGDPLVLERPPPR 35 >SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 90 IRRRPNSCSPGDPLVLERPPPR 25 I R NSCSPGDPLVLERPPPR Sbjct: 11 IHRASNSCSPGDPLVLERPPPR 32 >SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = -3 Query: 90 IRRRPNSCSPGDPLVLERPPPR 25 +RR NSCSPGDPLVLERPPPR Sbjct: 1 MRRVSNSCSPGDPLVLERPPPR 22 >SB_37747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 46.0 bits (104), Expect = 3e-05 Identities = 17/22 (77%), Positives = 21/22 (95%) Frame = -3 Query: 90 IRRRPNSCSPGDPLVLERPPPR 25 ++++ NSCSPGDPLVLERPPPR Sbjct: 2 LKKKSNSCSPGDPLVLERPPPR 23 >SB_16924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 90 IRRRPNSCSPGDPLVLERPPPR 25 IR NSCSPGDPLVLERPPPR Sbjct: 13 IRNTSNSCSPGDPLVLERPPPR 34 >SB_5222| Best HMM Match : Ras (HMM E-Value=2.9e-09) Length = 181 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -3 Query: 87 RRRPNSCSPGDPLVLERPPPR 25 RR NSCSPGDPLVLERPPPR Sbjct: 69 RRGSNSCSPGDPLVLERPPPR 89 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 87 RRRPNSCSPGDPLVLERPPPR 25 R + NSCSPGDPLVLERPPPR Sbjct: 9 REKSNSCSPGDPLVLERPPPR 29 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -3 Query: 93 GIRRRPNSCSPGDPLVLERPPPR 25 G+ + NSCSPGDPLVLERPPPR Sbjct: 2 GLSTQSNSCSPGDPLVLERPPPR 24 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 84 RRPNSCSPGDPLVLERPPPR 25 +R NSCSPGDPLVLERPPPR Sbjct: 874 KRSNSCSPGDPLVLERPPPR 893 >SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 45.6 bits (103), Expect = 4e-05 Identities = 19/25 (76%), Positives = 20/25 (80%) Frame = -3 Query: 99 NEGIRRRPNSCSPGDPLVLERPPPR 25 +E R NSCSPGDPLVLERPPPR Sbjct: 47 HEASRSASNSCSPGDPLVLERPPPR 71 >SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -3 Query: 90 IRRRPNSCSPGDPLVLERPPPR 25 +R+ NSCSPGDPLVLERPPPR Sbjct: 30 MRKTSNSCSPGDPLVLERPPPR 51 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 45.6 bits (103), Expect = 4e-05 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -3 Query: 87 RRRPNSCSPGDPLVLERPPPR 25 RR NSCSPGDPLVLERPPPR Sbjct: 182 RRVSNSCSPGDPLVLERPPPR 202 >SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 84 RRPNSCSPGDPLVLERPPPR 25 R+ NSCSPGDPLVLERPPPR Sbjct: 21 RKSNSCSPGDPLVLERPPPR 40 >SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 45.6 bits (103), Expect = 4e-05 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = -3 Query: 90 IRRRPNSCSPGDPLVLERPPPR 25 I R+ NSCSPGDPLVLERPPPR Sbjct: 21 IIRQSNSCSPGDPLVLERPPPR 42 >SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 84 RRPNSCSPGDPLVLERPPPR 25 +R NSCSPGDPLVLERPPPR Sbjct: 25 KRSNSCSPGDPLVLERPPPR 44 >SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 45.6 bits (103), Expect = 4e-05 Identities = 20/34 (58%), Positives = 23/34 (67%) Frame = -3 Query: 126 DLNE*RSAANEGIRRRPNSCSPGDPLVLERPPPR 25 D++ R + R NSCSPGDPLVLERPPPR Sbjct: 8 DMDRHRDIDRDTDRHLSNSCSPGDPLVLERPPPR 41 >SB_36996| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 84 RRPNSCSPGDPLVLERPPPR 25 R+ NSCSPGDPLVLERPPPR Sbjct: 2 RKSNSCSPGDPLVLERPPPR 21 >SB_34552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 45.6 bits (103), Expect = 4e-05 Identities = 20/23 (86%), Positives = 21/23 (91%), Gaps = 2/23 (8%) Frame = -3 Query: 87 RRRP--NSCSPGDPLVLERPPPR 25 RR+P NSCSPGDPLVLERPPPR Sbjct: 27 RRKPQSNSCSPGDPLVLERPPPR 49 >SB_31086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 45.6 bits (103), Expect = 4e-05 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 90 IRRRPNSCSPGDPLVLERPPPR 25 I R NSCSPGDPLVLERPPPR Sbjct: 22 IGHRSNSCSPGDPLVLERPPPR 43 >SB_23941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -3 Query: 90 IRRRPNSCSPGDPLVLERPPPR 25 +R NSCSPGDPLVLERPPPR Sbjct: 4 VRHTSNSCSPGDPLVLERPPPR 25 >SB_3006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 45.6 bits (103), Expect = 4e-05 Identities = 21/26 (80%), Positives = 22/26 (84%), Gaps = 1/26 (3%) Frame = -3 Query: 99 NEGIRRRP-NSCSPGDPLVLERPPPR 25 N GI +P NSCSPGDPLVLERPPPR Sbjct: 7 NFGIIPKPSNSCSPGDPLVLERPPPR 32 >SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 45.2 bits (102), Expect = 5e-05 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -3 Query: 99 NEGIRRRPNSCSPGDPLVLERPPPR 25 ++ I + NSCSPGDPLVLERPPPR Sbjct: 28 SQDISKTSNSCSPGDPLVLERPPPR 52 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = -3 Query: 96 EGIRRRPNSCSPGDPLVLERPPPR 25 +GI NSCSPGDPLVLERPPPR Sbjct: 74 KGILLTSNSCSPGDPLVLERPPPR 97 >SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 45.2 bits (102), Expect = 5e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 84 RRPNSCSPGDPLVLERPPPR 25 +R NSCSPGDPLVLERPPPR Sbjct: 109 QRSNSCSPGDPLVLERPPPR 128 >SB_52165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/28 (67%), Positives = 20/28 (71%) Frame = -3 Query: 108 SAANEGIRRRPNSCSPGDPLVLERPPPR 25 S G+ NSCSPGDPLVLERPPPR Sbjct: 11 SGKASGLHSGSNSCSPGDPLVLERPPPR 38 >SB_51469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 45.2 bits (102), Expect = 5e-05 Identities = 20/24 (83%), Positives = 20/24 (83%), Gaps = 1/24 (4%) Frame = -3 Query: 93 GIRRRP-NSCSPGDPLVLERPPPR 25 G R P NSCSPGDPLVLERPPPR Sbjct: 9 GSRHEPSNSCSPGDPLVLERPPPR 32 >SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 45.2 bits (102), Expect = 5e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 84 RRPNSCSPGDPLVLERPPPR 25 +R NSCSPGDPLVLERPPPR Sbjct: 28 QRSNSCSPGDPLVLERPPPR 47 >SB_41531| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 45.2 bits (102), Expect = 5e-05 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 87 RRRPNSCSPGDPLVLERPPPR 25 + R NSCSPGDPLVLERPPPR Sbjct: 1 KTRSNSCSPGDPLVLERPPPR 21 >SB_36738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 45.2 bits (102), Expect = 5e-05 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 87 RRRPNSCSPGDPLVLERPPPR 25 +R NSCSPGDPLVLERPPPR Sbjct: 4 KRSSNSCSPGDPLVLERPPPR 24 >SB_24720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 45.2 bits (102), Expect = 5e-05 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -3 Query: 108 SAANEGIRRRPNSCSPGDPLVLERPPPR 25 SA NE R NSCSPGDPLVLERPPPR Sbjct: 2 SARNE----RSNSCSPGDPLVLERPPPR 25 >SB_24360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 45.2 bits (102), Expect = 5e-05 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 87 RRRPNSCSPGDPLVLERPPPR 25 R + NSCSPGDPLVLERPPPR Sbjct: 2 RSKSNSCSPGDPLVLERPPPR 22 >SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 45.2 bits (102), Expect = 5e-05 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 87 RRRPNSCSPGDPLVLERPPPR 25 + R NSCSPGDPLVLERPPPR Sbjct: 5 KSRSNSCSPGDPLVLERPPPR 25 >SB_20081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 45.2 bits (102), Expect = 5e-05 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -3 Query: 93 GIRRRPNSCSPGDPLVLERPPPR 25 G ++ NSCSPGDPLVLERPPPR Sbjct: 45 GEKKTSNSCSPGDPLVLERPPPR 67 >SB_7708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 45.2 bits (102), Expect = 5e-05 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 87 RRRPNSCSPGDPLVLERPPPR 25 +R NSCSPGDPLVLERPPPR Sbjct: 3 KRASNSCSPGDPLVLERPPPR 23 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 3 RSNSCSPGDPLVLERPPPR 21 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 21 RSNSCSPGDPLVLERPPPR 39 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 10 RSNSCSPGDPLVLERPPPR 28 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 12 RSNSCSPGDPLVLERPPPR 30 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 16 RSNSCSPGDPLVLERPPPR 34 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 4 RSNSCSPGDPLVLERPPPR 22 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 13 RSNSCSPGDPLVLERPPPR 31 >SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 44.8 bits (101), Expect = 7e-05 Identities = 19/29 (65%), Positives = 20/29 (68%) Frame = -3 Query: 111 RSAANEGIRRRPNSCSPGDPLVLERPPPR 25 R G + NSCSPGDPLVLERPPPR Sbjct: 10 RGYLRRGSQTASNSCSPGDPLVLERPPPR 38 >SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 39 RSNSCSPGDPLVLERPPPR 57 >SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 3 RSNSCSPGDPLVLERPPPR 21 >SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 3 RSNSCSPGDPLVLERPPPR 21 >SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 4 RSNSCSPGDPLVLERPPPR 22 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 44.8 bits (101), Expect = 7e-05 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = -3 Query: 96 EGIRRRPNSCSPGDPLVLERPPPR 25 E + R NSCSPGDPLVLERPPPR Sbjct: 35 EFVLRVSNSCSPGDPLVLERPPPR 58 >SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 66 RSNSCSPGDPLVLERPPPR 84 >SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 63 RSNSCSPGDPLVLERPPPR 81 >SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -3 Query: 84 RRPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 76 RESNSCSPGDPLVLERPPPR 95 >SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.8 bits (101), Expect = 7e-05 Identities = 17/22 (77%), Positives = 20/22 (90%) Frame = -3 Query: 90 IRRRPNSCSPGDPLVLERPPPR 25 +++ NSCSPGDPLVLERPPPR Sbjct: 2 LKKSSNSCSPGDPLVLERPPPR 23 >SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 69 RSNSCSPGDPLVLERPPPR 87 >SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 44.8 bits (101), Expect = 7e-05 Identities = 22/44 (50%), Positives = 24/44 (54%) Frame = -3 Query: 156 LSHFDDRGRVDLNE*RSAANEGIRRRPNSCSPGDPLVLERPPPR 25 + HF D + N N NSCSPGDPLVLERPPPR Sbjct: 1 MKHFTDT-LISANISYPKRNSNSHTASNSCSPGDPLVLERPPPR 43 >SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 558 RSNSCSPGDPLVLERPPPR 576 >SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 15 RSNSCSPGDPLVLERPPPR 33 >SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 8 RSNSCSPGDPLVLERPPPR 26 >SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 5 RSNSCSPGDPLVLERPPPR 23 >SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 31 RSNSCSPGDPLVLERPPPR 49 >SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 3 RSNSCSPGDPLVLERPPPR 21 >SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = -3 Query: 99 NEGIRRRPNSCSPGDPLVLERPPPR 25 N + + NSCSPGDPLVLERPPPR Sbjct: 146 NSRLEKISNSCSPGDPLVLERPPPR 170 >SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 3 RSNSCSPGDPLVLERPPPR 21 >SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 92 RSNSCSPGDPLVLERPPPR 110 >SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 20 RSNSCSPGDPLVLERPPPR 38 >SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 54 RSNSCSPGDPLVLERPPPR 72 >SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 7 RSNSCSPGDPLVLERPPPR 25 >SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 64 RSNSCSPGDPLVLERPPPR 82 >SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -3 Query: 90 IRRRPNSCSPGDPLVLERPPPR 25 +R NSCSPGDPLVLERPPPR Sbjct: 53 VRALSNSCSPGDPLVLERPPPR 74 >SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 26 RSNSCSPGDPLVLERPPPR 44 >SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 44.8 bits (101), Expect = 7e-05 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = -3 Query: 96 EGIRRRPNSCSPGDPLVLERPPPR 25 EG + NSCSPGDPLVLERPPPR Sbjct: 26 EGNKDVSNSCSPGDPLVLERPPPR 49 >SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 11 RSNSCSPGDPLVLERPPPR 29 >SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 17 RSNSCSPGDPLVLERPPPR 35 >SB_34798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 44.8 bits (101), Expect = 7e-05 Identities = 17/22 (77%), Positives = 20/22 (90%) Frame = -3 Query: 90 IRRRPNSCSPGDPLVLERPPPR 25 +++ NSCSPGDPLVLERPPPR Sbjct: 10 LKKASNSCSPGDPLVLERPPPR 31 >SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 45 RSNSCSPGDPLVLERPPPR 63 >SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 16 RSNSCSPGDPLVLERPPPR 34 >SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 44.8 bits (101), Expect = 7e-05 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 105 AANEGIRRRPNSCSPGDPLVLERPPPR 25 AAN NSCSPGDPLVLERPPPR Sbjct: 64 AANFVTATESNSCSPGDPLVLERPPPR 90 >SB_28183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -3 Query: 84 RRPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 17 RESNSCSPGDPLVLERPPPR 36 >SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 14 RSNSCSPGDPLVLERPPPR 32 >SB_20823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 8 RSNSCSPGDPLVLERPPPR 26 >SB_18474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 12 RSNSCSPGDPLVLERPPPR 30 >SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 55 RSNSCSPGDPLVLERPPPR 73 >SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 14 RSNSCSPGDPLVLERPPPR 32 >SB_17014| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.8 bits (101), Expect = 7e-05 Identities = 21/26 (80%), Positives = 21/26 (80%), Gaps = 2/26 (7%) Frame = -3 Query: 96 EGIRR--RPNSCSPGDPLVLERPPPR 25 EG RR NSCSPGDPLVLERPPPR Sbjct: 8 EGSRRLQTSNSCSPGDPLVLERPPPR 33 >SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 44.8 bits (101), Expect = 7e-05 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = -3 Query: 93 GIRRRPNSCSPGDPLVLERPPPR 25 GI NSCSPGDPLVLERPPPR Sbjct: 17 GICAASNSCSPGDPLVLERPPPR 39 >SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 54 RSNSCSPGDPLVLERPPPR 72 >SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 19 RSNSCSPGDPLVLERPPPR 37 >SB_6419| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 44.8 bits (101), Expect = 7e-05 Identities = 20/48 (41%), Positives = 27/48 (56%) Frame = -3 Query: 168 GVRTLSHFDDRGRVDLNE*RSAANEGIRRRPNSCSPGDPLVLERPPPR 25 G ++H G++++ + NSCSPGDPLVLERPPPR Sbjct: 21 GEMEVTHTHYLGQMEVTHTHYLGEMEVTHTSNSCSPGDPLVLERPPPR 68 >SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -3 Query: 96 EGIRRRPNSCSPGDPLVLERPPPR 25 +G + NSCSPGDPLVLERPPPR Sbjct: 25 KGAKEISNSCSPGDPLVLERPPPR 48 >SB_5303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 1 RSNSCSPGDPLVLERPPPR 19 >SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 5 RSNSCSPGDPLVLERPPPR 23 >SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 5 RSNSCSPGDPLVLERPPPR 23 >SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 35 RSNSCSPGDPLVLERPPPR 53 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 44.4 bits (100), Expect = 9e-05 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -3 Query: 90 IRRRPNSCSPGDPLVLERPPPR 25 + R NSCSPGDPLVLERPPPR Sbjct: 23 VPRPSNSCSPGDPLVLERPPPR 44 >SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 90 IRRRPNSCSPGDPLVLERPPPR 25 IR NSCSPGDPLVLERPPPR Sbjct: 7 IRGISNSCSPGDPLVLERPPPR 28 >SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 44.4 bits (100), Expect = 9e-05 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -3 Query: 84 RRPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 101 RTSNSCSPGDPLVLERPPPR 120 >SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 44.4 bits (100), Expect = 9e-05 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -3 Query: 84 RRPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 9 RASNSCSPGDPLVLERPPPR 28 >SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 44.4 bits (100), Expect = 9e-05 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = -3 Query: 99 NEGIRRRPNSCSPGDPLVLERPPPR 25 N ++ NSCSPGDPLVLERPPPR Sbjct: 29 NAPLKLSSNSCSPGDPLVLERPPPR 53 >SB_741| Best HMM Match : Agenet (HMM E-Value=7.4) Length = 181 Score = 44.4 bits (100), Expect = 9e-05 Identities = 23/45 (51%), Positives = 27/45 (60%) Frame = -3 Query: 159 TLSHFDDRGRVDLNE*RSAANEGIRRRPNSCSPGDPLVLERPPPR 25 TL D+ GR D R +E ++ S SPGDPLVLERPPPR Sbjct: 32 TLYVIDEDGRSDFTI-RDICSEALKSLARSHSPGDPLVLERPPPR 75 >SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 44.4 bits (100), Expect = 9e-05 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -3 Query: 84 RRPNSCSPGDPLVLERPPPR 25 ++ NSCSPGDPLVLERPPPR Sbjct: 20 KKSNSCSPGDPLVLERPPPR 39 >SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 44.4 bits (100), Expect = 9e-05 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -3 Query: 102 ANEGIRRRPNSCSPGDPLVLERPPPR 25 A + ++ NSCSPGDPLVLERPPPR Sbjct: 21 AEKHVKFTSNSCSPGDPLVLERPPPR 46 >SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 44.4 bits (100), Expect = 9e-05 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -3 Query: 84 RRPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 6 RTSNSCSPGDPLVLERPPPR 25 >SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 44.4 bits (100), Expect = 9e-05 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -3 Query: 84 RRPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 51 RASNSCSPGDPLVLERPPPR 70 >SB_37222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/26 (73%), Positives = 22/26 (84%), Gaps = 2/26 (7%) Frame = -3 Query: 96 EGIRR--RPNSCSPGDPLVLERPPPR 25 +G+R+ NSCSPGDPLVLERPPPR Sbjct: 29 QGLRKLCESNSCSPGDPLVLERPPPR 54 >SB_36586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 44.4 bits (100), Expect = 9e-05 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -3 Query: 84 RRPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 10 RTSNSCSPGDPLVLERPPPR 29 >SB_34686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/23 (82%), Positives = 21/23 (91%), Gaps = 1/23 (4%) Frame = -3 Query: 90 IRRRP-NSCSPGDPLVLERPPPR 25 +R +P NSCSPGDPLVLERPPPR Sbjct: 5 VRVKPSNSCSPGDPLVLERPPPR 27 >SB_34241| Best HMM Match : RuvA_C (HMM E-Value=1.5) Length = 274 Score = 44.4 bits (100), Expect = 9e-05 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = -3 Query: 96 EGIRRRPNSCSPGDPLVLERPPPR 25 E + NSCSPGDPLVLERPPPR Sbjct: 145 EEVANSSNSCSPGDPLVLERPPPR 168 >SB_33797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/29 (65%), Positives = 22/29 (75%) Frame = -3 Query: 111 RSAANEGIRRRPNSCSPGDPLVLERPPPR 25 +S+ +G NSCSPGDPLVLERPPPR Sbjct: 21 KSSKRQGGVTGSNSCSPGDPLVLERPPPR 49 >SB_32003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.4 bits (100), Expect = 9e-05 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -3 Query: 84 RRPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 11 RTSNSCSPGDPLVLERPPPR 30 >SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) Length = 126 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/26 (73%), Positives = 20/26 (76%) Frame = -3 Query: 102 ANEGIRRRPNSCSPGDPLVLERPPPR 25 + E R NSCSPGDPLVLERPPPR Sbjct: 25 STESPRSISNSCSPGDPLVLERPPPR 50 >SB_30190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 44.4 bits (100), Expect = 9e-05 Identities = 17/22 (77%), Positives = 20/22 (90%) Frame = -3 Query: 90 IRRRPNSCSPGDPLVLERPPPR 25 +++ NSCSPGDPLVLERPPPR Sbjct: 25 VQKGSNSCSPGDPLVLERPPPR 46 >SB_23253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = -3 Query: 108 SAANEGIRRRPNSCSPGDPLVLERPPPR 25 S N+ + NSCSPGDPLVLERPPPR Sbjct: 30 SKLNKTAIKASNSCSPGDPLVLERPPPR 57 >SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 44.4 bits (100), Expect = 9e-05 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -3 Query: 84 RRPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 9 RASNSCSPGDPLVLERPPPR 28 >SB_18776| Best HMM Match : DUF765 (HMM E-Value=4) Length = 134 Score = 44.4 bits (100), Expect = 9e-05 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -3 Query: 90 IRRRPNSCSPGDPLVLERPPPR 25 I + NSCSPGDPLVLERPPPR Sbjct: 7 ISKTSNSCSPGDPLVLERPPPR 28 >SB_11970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.4 bits (100), Expect = 9e-05 Identities = 20/25 (80%), Positives = 20/25 (80%), Gaps = 2/25 (8%) Frame = -3 Query: 93 GIRRRP--NSCSPGDPLVLERPPPR 25 G RP NSCSPGDPLVLERPPPR Sbjct: 6 GTTERPGSNSCSPGDPLVLERPPPR 30 >SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 90 IRRRPNSCSPGDPLVLERPPPR 25 IR NSCSPGDPLVLERPPPR Sbjct: 7 IRYISNSCSPGDPLVLERPPPR 28 >SB_132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 44.4 bits (100), Expect = 9e-05 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -3 Query: 84 RRPNSCSPGDPLVLERPPPR 25 ++ NSCSPGDPLVLERPPPR Sbjct: 5 KKSNSCSPGDPLVLERPPPR 24 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -3 Query: 87 RRRPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 4 RNGSNSCSPGDPLVLERPPPR 24 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -3 Query: 87 RRRPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 15 RTTSNSCSPGDPLVLERPPPR 35 >SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -3 Query: 84 RRPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 23 RLSNSCSPGDPLVLERPPPR 42 >SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -3 Query: 84 RRPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 16 RPSNSCSPGDPLVLERPPPR 35 >SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = -3 Query: 108 SAANEGIRRRPNSCSPGDPLVLERPPPR 25 SA +G NSCSPGDPLVLERPPPR Sbjct: 10 SANIKGRHCASNSCSPGDPLVLERPPPR 37 >SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -3 Query: 84 RRPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 39 RGSNSCSPGDPLVLERPPPR 58 >SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) Length = 186 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -3 Query: 93 GIRRRPNSCSPGDPLVLERPPPR 25 G + NSCSPGDPLVLERPPPR Sbjct: 58 GALSQSNSCSPGDPLVLERPPPR 80 >SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -3 Query: 87 RRRPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 40 RSSSNSCSPGDPLVLERPPPR 60 >SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -3 Query: 90 IRRRPNSCSPGDPLVLERPPPR 25 I + NSCSPGDPLVLERPPPR Sbjct: 13 IGKTSNSCSPGDPLVLERPPPR 34 >SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) Length = 365 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -3 Query: 87 RRRPNSCSPGDPLVLERPPPR 25 ++ NSCSPGDPLVLERPPPR Sbjct: 239 KKTSNSCSPGDPLVLERPPPR 259 >SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -3 Query: 90 IRRRPNSCSPGDPLVLERPPPR 25 I+ NSCSPGDPLVLERPPPR Sbjct: 13 IKAGSNSCSPGDPLVLERPPPR 34 >SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = -3 Query: 99 NEGIRRRPNSCSPGDPLVLERPPPR 25 N + NSCSPGDPLVLERPPPR Sbjct: 2 NSRFQATSNSCSPGDPLVLERPPPR 26 >SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -3 Query: 84 RRPNSCSPGDPLVLERPPPR 25 ++ NSCSPGDPLVLERPPPR Sbjct: 70 QKSNSCSPGDPLVLERPPPR 89 >SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.0 bits (99), Expect = 1e-04 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = -3 Query: 93 GIRRRPNSCSPGDPLVLERPPPR 25 GI NSCSPGDPLVLERPPPR Sbjct: 30 GIGVLSNSCSPGDPLVLERPPPR 52 >SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -3 Query: 90 IRRRPNSCSPGDPLVLERPPPR 25 +R NSCSPGDPLVLERPPPR Sbjct: 1 MRLSSNSCSPGDPLVLERPPPR 22 >SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -3 Query: 96 EGIRRRPNSCSPGDPLVLERPPPR 25 +G + NSCSPGDPLVLERPPPR Sbjct: 15 QGNCMKSNSCSPGDPLVLERPPPR 38 >SB_46157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/22 (77%), Positives = 20/22 (90%) Frame = -3 Query: 90 IRRRPNSCSPGDPLVLERPPPR 25 +++ NSCSPGDPLVLERPPPR Sbjct: 1 MKKGSNSCSPGDPLVLERPPPR 22 >SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -3 Query: 84 RRPNSCSPGDPLVLERPPPR 25 ++ NSCSPGDPLVLERPPPR Sbjct: 13 QKSNSCSPGDPLVLERPPPR 32 >SB_42272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 87 RRRPNSCSPGDPLVLERPPPR 25 R + NSCSPGDPLVLERPPPR Sbjct: 11 RIQSNSCSPGDPLVLERPPPR 31 >SB_41735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = -3 Query: 96 EGIRRRPNSCSPGDPLVLERPPPR 25 +G NSCSPGDPLVLERPPPR Sbjct: 2 KGFFHASNSCSPGDPLVLERPPPR 25 >SB_22502| Best HMM Match : FtsL (HMM E-Value=0.0086) Length = 167 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = -3 Query: 99 NEGIRRRPNSCSPGDPLVLERPPPR 25 N + NSCSPGDPLVLERPPPR Sbjct: 37 NRQLLNASNSCSPGDPLVLERPPPR 61 >SB_22214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -3 Query: 84 RRPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 25 RGSNSCSPGDPLVLERPPPR 44 >SB_19132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -3 Query: 87 RRRPNSCSPGDPLVLERPPPR 25 + + NSCSPGDPLVLERPPPR Sbjct: 16 KAKSNSCSPGDPLVLERPPPR 36 >SB_18165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 44.0 bits (99), Expect = 1e-04 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = -3 Query: 126 DLNE*RSAANEGIRRRPNSCSPGDPLVLERPPPR 25 DL E A E + NSCSPGDPLVLERPPPR Sbjct: 35 DLGE-YGKAIEAEEGQSNSCSPGDPLVLERPPPR 67 >SB_17626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 44.0 bits (99), Expect = 1e-04 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = -3 Query: 108 SAANEGIRRRPNSCSPGDPLVLERPPPR 25 S AN+G NSCSPGDPLVLERPPPR Sbjct: 38 SRANKG----SNSCSPGDPLVLERPPPR 61 >SB_16765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -3 Query: 84 RRPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 10 RGSNSCSPGDPLVLERPPPR 29 >SB_15537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -3 Query: 93 GIRRRPNSCSPGDPLVLERPPPR 25 G+ NSCSPGDPLVLERPPPR Sbjct: 21 GLSPGSNSCSPGDPLVLERPPPR 43 >SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.0 bits (99), Expect = 1e-04 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -3 Query: 105 AANEGIRRRPNSCSPGDPLVLERPPPR 25 +AN + NSCSPGDPLVLERPPPR Sbjct: 10 SANIANAKVSNSCSPGDPLVLERPPPR 36 >SB_5062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -3 Query: 84 RRPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 13 RLSNSCSPGDPLVLERPPPR 32 >SB_1736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -3 Query: 90 IRRRPNSCSPGDPLVLERPPPR 25 I + NSCSPGDPLVLERPPPR Sbjct: 13 ISQTSNSCSPGDPLVLERPPPR 34 >SB_1318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -3 Query: 87 RRRPNSCSPGDPLVLERPPPR 25 ++ NSCSPGDPLVLERPPPR Sbjct: 4 KKASNSCSPGDPLVLERPPPR 24 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -3 Query: 84 RRPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 6 RVSNSCSPGDPLVLERPPPR 25 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = -3 Query: 105 AANEGIRRRPNSCSPGDPLVLERPPPR 25 +AN NSCSPGDPLVLERPPPR Sbjct: 10 SANIVSHNTSNSCSPGDPLVLERPPPR 36 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/22 (77%), Positives = 20/22 (90%) Frame = -3 Query: 90 IRRRPNSCSPGDPLVLERPPPR 25 +++ NSCSPGDPLVLERPPPR Sbjct: 13 VQQISNSCSPGDPLVLERPPPR 34 >SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -3 Query: 87 RRRPNSCSPGDPLVLERPPPR 25 ++ NSCSPGDPLVLERPPPR Sbjct: 60 KKLSNSCSPGDPLVLERPPPR 80 >SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = -3 Query: 90 IRRRPNSCSPGDPLVLERPPPR 25 + + NSCSPGDPLVLERPPPR Sbjct: 20 VASQSNSCSPGDPLVLERPPPR 41 >SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = -3 Query: 96 EGIRRRPNSCSPGDPLVLERPPPR 25 + R NSCSPGDPLVLERPPPR Sbjct: 13 KSFRVTSNSCSPGDPLVLERPPPR 36 >SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) Length = 174 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -3 Query: 111 RSAANEGIRRRPNSCSPGDPLVLERPPPR 25 +S NE NSCSPGDPLVLERPPPR Sbjct: 40 KSRPNEEWIFLSNSCSPGDPLVLERPPPR 68 >SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -3 Query: 90 IRRRPNSCSPGDPLVLERPPPR 25 I+ NSCSPGDPLVLERPPPR Sbjct: 16 IKITSNSCSPGDPLVLERPPPR 37 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -3 Query: 84 RRPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 31 RVSNSCSPGDPLVLERPPPR 50 >SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -3 Query: 90 IRRRPNSCSPGDPLVLERPPPR 25 +R NSCSPGDPLVLERPPPR Sbjct: 75 LRFLSNSCSPGDPLVLERPPPR 96 >SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) Length = 214 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 + NSCSPGDPLVLERPPPR Sbjct: 188 KSNSCSPGDPLVLERPPPR 206 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -3 Query: 90 IRRRPNSCSPGDPLVLERPPPR 25 +R NSCSPGDPLVLERPPPR Sbjct: 61 LRPVSNSCSPGDPLVLERPPPR 82 >SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/30 (70%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Frame = -3 Query: 111 RSAANEGIRR-RPNSCSPGDPLVLERPPPR 25 R AN R NSCSPGDPLVLERPPPR Sbjct: 9 REGANISCGRFASNSCSPGDPLVLERPPPR 38 >SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/22 (86%), Positives = 20/22 (90%), Gaps = 2/22 (9%) Frame = -3 Query: 84 RRP--NSCSPGDPLVLERPPPR 25 R+P NSCSPGDPLVLERPPPR Sbjct: 37 RKPPSNSCSPGDPLVLERPPPR 58 >SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -3 Query: 90 IRRRPNSCSPGDPLVLERPPPR 25 +R NSCSPGDPLVLERPPPR Sbjct: 23 MRITSNSCSPGDPLVLERPPPR 44 >SB_47610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -3 Query: 87 RRRPNSCSPGDPLVLERPPPR 25 ++ NSCSPGDPLVLERPPPR Sbjct: 3 KKGSNSCSPGDPLVLERPPPR 23 >SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -3 Query: 84 RRPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 31 RISNSCSPGDPLVLERPPPR 50 >SB_43717| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -3 Query: 93 GIRRRPNSCSPGDPLVLERPPPR 25 G + NSCSPGDPLVLERPPPR Sbjct: 2 GTVQASNSCSPGDPLVLERPPPR 24 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/28 (71%), Positives = 22/28 (78%), Gaps = 3/28 (10%) Frame = -3 Query: 99 NEGIRRRP---NSCSPGDPLVLERPPPR 25 +E +R P NSCSPGDPLVLERPPPR Sbjct: 50 SENLRTIPPVSNSCSPGDPLVLERPPPR 77 >SB_39410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/22 (81%), Positives = 18/22 (81%) Frame = -3 Query: 90 IRRRPNSCSPGDPLVLERPPPR 25 I NSCSPGDPLVLERPPPR Sbjct: 21 INNLSNSCSPGDPLVLERPPPR 42 >SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -3 Query: 87 RRRPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 21 RSLSNSCSPGDPLVLERPPPR 41 >SB_32594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 + NSCSPGDPLVLERPPPR Sbjct: 3 KSNSCSPGDPLVLERPPPR 21 >SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/29 (65%), Positives = 20/29 (68%) Frame = -3 Query: 111 RSAANEGIRRRPNSCSPGDPLVLERPPPR 25 +S E NSCSPGDPLVLERPPPR Sbjct: 11 QSNVREAAPLASNSCSPGDPLVLERPPPR 39 >SB_30117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -3 Query: 84 RRPNSCSPGDPLVLERPPPR 25 + NSCSPGDPLVLERPPPR Sbjct: 27 KESNSCSPGDPLVLERPPPR 46 >SB_29704| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -3 Query: 87 RRRPNSCSPGDPLVLERPPPR 25 ++ NSCSPGDPLVLERPPPR Sbjct: 20 KQSSNSCSPGDPLVLERPPPR 40 >SB_28661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 81 RPNSCSPGDPLVLERPPPR 25 + NSCSPGDPLVLERPPPR Sbjct: 11 KSNSCSPGDPLVLERPPPR 29 >SB_22083| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = -3 Query: 99 NEGIRRRPNSCSPGDPLVLERPPPR 25 NE NSCSPGDPLVLERPPPR Sbjct: 13 NEWKLELSNSCSPGDPLVLERPPPR 37 >SB_16436| Best HMM Match : DUF765 (HMM E-Value=9.2) Length = 129 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -3 Query: 87 RRRPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 4 RPTSNSCSPGDPLVLERPPPR 24 >SB_10667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = -3 Query: 99 NEGIRRRPNSCSPGDPLVLERPPPR 25 N R NSCSPGDPLVLERPPPR Sbjct: 58 NRITRGGSNSCSPGDPLVLERPPPR 82 >SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -3 Query: 84 RRPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 8 RVSNSCSPGDPLVLERPPPR 27 >SB_4378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/22 (81%), Positives = 18/22 (81%) Frame = -3 Query: 90 IRRRPNSCSPGDPLVLERPPPR 25 I NSCSPGDPLVLERPPPR Sbjct: 30 IHSASNSCSPGDPLVLERPPPR 51 >SB_4147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/29 (68%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -3 Query: 108 SAANEGIRRRP-NSCSPGDPLVLERPPPR 25 S N G + NSCSPGDPLVLERPPPR Sbjct: 8 SLCNNGPHEQTSNSCSPGDPLVLERPPPR 36 >SB_3957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -3 Query: 87 RRRPNSCSPGDPLVLERPPPR 25 R NSCSPGDPLVLERPPPR Sbjct: 14 RVESNSCSPGDPLVLERPPPR 34 >SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) Length = 221 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/27 (74%), Positives = 22/27 (81%), Gaps = 2/27 (7%) Frame = -3 Query: 99 NEGIRRR--PNSCSPGDPLVLERPPPR 25 +E I+R NSCSPGDPLVLERPPPR Sbjct: 89 HEDIKRALASNSCSPGDPLVLERPPPR 115 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 75 NSCSPGDPLVLERPPPR 25 NSCSPGDPLVLERPPPR Sbjct: 36 NSCSPGDPLVLERPPPR 52 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 75 NSCSPGDPLVLERPPPR 25 NSCSPGDPLVLERPPPR Sbjct: 27 NSCSPGDPLVLERPPPR 43 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 75 NSCSPGDPLVLERPPPR 25 NSCSPGDPLVLERPPPR Sbjct: 4 NSCSPGDPLVLERPPPR 20 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 75 NSCSPGDPLVLERPPPR 25 NSCSPGDPLVLERPPPR Sbjct: 19 NSCSPGDPLVLERPPPR 35 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 75 NSCSPGDPLVLERPPPR 25 NSCSPGDPLVLERPPPR Sbjct: 185 NSCSPGDPLVLERPPPR 201 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 75 NSCSPGDPLVLERPPPR 25 NSCSPGDPLVLERPPPR Sbjct: 80 NSCSPGDPLVLERPPPR 96 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 75 NSCSPGDPLVLERPPPR 25 NSCSPGDPLVLERPPPR Sbjct: 16 NSCSPGDPLVLERPPPR 32 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 75 NSCSPGDPLVLERPPPR 25 NSCSPGDPLVLERPPPR Sbjct: 350 NSCSPGDPLVLERPPPR 366 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 75 NSCSPGDPLVLERPPPR 25 NSCSPGDPLVLERPPPR Sbjct: 7 NSCSPGDPLVLERPPPR 23 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 75 NSCSPGDPLVLERPPPR 25 NSCSPGDPLVLERPPPR Sbjct: 19 NSCSPGDPLVLERPPPR 35 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 75 NSCSPGDPLVLERPPPR 25 NSCSPGDPLVLERPPPR Sbjct: 28 NSCSPGDPLVLERPPPR 44 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 75 NSCSPGDPLVLERPPPR 25 NSCSPGDPLVLERPPPR Sbjct: 12 NSCSPGDPLVLERPPPR 28 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 75 NSCSPGDPLVLERPPPR 25 NSCSPGDPLVLERPPPR Sbjct: 103 NSCSPGDPLVLERPPPR 119 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 75 NSCSPGDPLVLERPPPR 25 NSCSPGDPLVLERPPPR Sbjct: 32 NSCSPGDPLVLERPPPR 48 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 75 NSCSPGDPLVLERPPPR 25 NSCSPGDPLVLERPPPR Sbjct: 8 NSCSPGDPLVLERPPPR 24 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 75 NSCSPGDPLVLERPPPR 25 NSCSPGDPLVLERPPPR Sbjct: 36 NSCSPGDPLVLERPPPR 52 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 75 NSCSPGDPLVLERPPPR 25 NSCSPGDPLVLERPPPR Sbjct: 83 NSCSPGDPLVLERPPPR 99 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 75 NSCSPGDPLVLERPPPR 25 NSCSPGDPLVLERPPPR Sbjct: 3 NSCSPGDPLVLERPPPR 19 >SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2070 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 75 NSCSPGDPLVLERPPPR 25 NSCSPGDPLVLERPPPR Sbjct: 517 NSCSPGDPLVLERPPPR 533 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 75 NSCSPGDPLVLERPPPR 25 NSCSPGDPLVLERPPPR Sbjct: 15 NSCSPGDPLVLERPPPR 31 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 75 NSCSPGDPLVLERPPPR 25 NSCSPGDPLVLERPPPR Sbjct: 23 NSCSPGDPLVLERPPPR 39 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 75 NSCSPGDPLVLERPPPR 25 NSCSPGDPLVLERPPPR Sbjct: 32 NSCSPGDPLVLERPPPR 48 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 75 NSCSPGDPLVLERPPPR 25 NSCSPGDPLVLERPPPR Sbjct: 3 NSCSPGDPLVLERPPPR 19 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 75 NSCSPGDPLVLERPPPR 25 NSCSPGDPLVLERPPPR Sbjct: 4 NSCSPGDPLVLERPPPR 20 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 75 NSCSPGDPLVLERPPPR 25 NSCSPGDPLVLERPPPR Sbjct: 18 NSCSPGDPLVLERPPPR 34 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 75 NSCSPGDPLVLERPPPR 25 NSCSPGDPLVLERPPPR Sbjct: 5 NSCSPGDPLVLERPPPR 21 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 75 NSCSPGDPLVLERPPPR 25 NSCSPGDPLVLERPPPR Sbjct: 263 NSCSPGDPLVLERPPPR 279 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 75 NSCSPGDPLVLERPPPR 25 NSCSPGDPLVLERPPPR Sbjct: 20 NSCSPGDPLVLERPPPR 36 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 75 NSCSPGDPLVLERPPPR 25 NSCSPGDPLVLERPPPR Sbjct: 12 NSCSPGDPLVLERPPPR 28 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 75 NSCSPGDPLVLERPPPR 25 NSCSPGDPLVLERPPPR Sbjct: 20 NSCSPGDPLVLERPPPR 36 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 75 NSCSPGDPLVLERPPPR 25 NSCSPGDPLVLERPPPR Sbjct: 164 NSCSPGDPLVLERPPPR 180 >SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) Length = 143 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 75 NSCSPGDPLVLERPPPR 25 NSCSPGDPLVLERPPPR Sbjct: 21 NSCSPGDPLVLERPPPR 37 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 75 NSCSPGDPLVLERPPPR 25 NSCSPGDPLVLERPPPR Sbjct: 22 NSCSPGDPLVLERPPPR 38 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 75 NSCSPGDPLVLERPPPR 25 NSCSPGDPLVLERPPPR Sbjct: 36 NSCSPGDPLVLERPPPR 52 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 75 NSCSPGDPLVLERPPPR 25 NSCSPGDPLVLERPPPR Sbjct: 65 NSCSPGDPLVLERPPPR 81 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 75 NSCSPGDPLVLERPPPR 25 NSCSPGDPLVLERPPPR Sbjct: 17 NSCSPGDPLVLERPPPR 33 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,250,396 Number of Sequences: 59808 Number of extensions: 532794 Number of successful extensions: 5478 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3821 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5478 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1913853903 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -