BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0120 (719 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 25 0.54 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 24 1.7 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 23 2.2 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 3.8 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 22 5.1 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 25.4 bits (53), Expect = 0.54 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -1 Query: 590 PVQTPARPKRGTRGEPPLGRPP 525 P Q+P P+RG+ P G PP Sbjct: 27 PHQSPQAPQRGSPPNPSQGPPP 48 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 23.8 bits (49), Expect = 1.7 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = -2 Query: 529 HLKIGDISPTCSISPAHSKPKMKGVFGGESMAP*RTIKSWKF 404 HLKI D TC + H P + G G MA T S+ + Sbjct: 322 HLKIHD---TCGVHNLHGMPGILGGIFGALMAALATEASYDY 360 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 23.4 bits (48), Expect = 2.2 Identities = 11/27 (40%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +3 Query: 483 AGEIEQVGEMSPILR-WATKWWLSPST 560 +G I V E P W T+W + PST Sbjct: 565 SGSINTVAEWEPPRALWPTEWKVRPST 591 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 22.6 bits (46), Expect = 3.8 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +2 Query: 392 SLRPKLPRFDSSSGRHRLSTEDSFHLGL 475 S+RPK P D+ +G LSTE L L Sbjct: 208 SVRPKFPSMDNING---LSTESKADLPL 232 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 22.2 bits (45), Expect = 5.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -3 Query: 84 RRPNSCSPGDPLVLERPPPR 25 R P PGD + +RP PR Sbjct: 914 RSPGRAWPGDSDIRQRPIPR 933 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 203,292 Number of Sequences: 438 Number of extensions: 4621 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22292145 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -