BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0119 (629 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q37953 Cluster: LacZ protein; n=1; Phage M13mp18|Rep: L... 117 3e-25 UniRef50_P00722 Cluster: Beta-galactosidase; n=35; root|Rep: Bet... 117 3e-25 UniRef50_Q8GEG0 Cluster: Putative uncharacterized protein; n=1; ... 115 1e-24 UniRef50_Q47336 Cluster: LacZ-alpha peptide; n=2; cellular organ... 105 9e-22 UniRef50_Q669R9 Cluster: Beta-galactosidase; n=14; Yersinia|Rep:... 77 5e-13 UniRef50_UPI0000498F17 Cluster: beta-galactosidase; n=3; Eukaryo... 76 8e-13 UniRef50_A7MN76 Cluster: Putative uncharacterized protein; n=1; ... 68 2e-10 UniRef50_P06219 Cluster: Beta-galactosidase; n=11; Gammaproteoba... 58 1e-07 UniRef50_A0ZLG1 Cluster: Beta-D-galactosidase; n=1; Nodularia sp... 57 4e-07 UniRef50_P81650 Cluster: Beta-galactosidase; n=26; Gammaproteoba... 54 3e-06 UniRef50_A6FJQ2 Cluster: 50S ribosomal protein L5; n=8; Bacteria... 52 2e-05 UniRef50_Q15XN9 Cluster: Glycoside hydrolase family 2, TIM barre... 48 2e-04 UniRef50_A6DI70 Cluster: Beta-D-galactosidase; n=1; Lentisphaera... 43 0.007 UniRef50_Q9JN59 Cluster: Beta-galactosidase; n=16; Vibrio choler... 42 0.009 UniRef50_A0M224 Cluster: Beta-galactosidase; n=1; Gramella forse... 42 0.009 UniRef50_A0UVE2 Cluster: Glycoside hydrolase family 2, TIM barre... 41 0.021 UniRef50_A7LU08 Cluster: Putative uncharacterized protein; n=1; ... 40 0.037 UniRef50_Q1II16 Cluster: Glycoside hydrolase family 2, TIM barre... 39 0.086 UniRef50_Q15NH4 Cluster: Glycoside hydrolase family 2, TIM barre... 38 0.20 UniRef50_A5FCG4 Cluster: Beta-galactosidase precursor; n=1; Flav... 38 0.26 UniRef50_A7CVC4 Cluster: Beta-galactosidase; n=1; Opitutaceae ba... 37 0.46 UniRef50_A3XMD4 Cluster: Beta-galactosidase; n=1; Leeuwenhoekiel... 37 0.46 UniRef50_Q8A2G5 Cluster: Beta-galactosidase; n=8; Bacteroidales|... 36 0.61 UniRef50_Q48727 Cluster: Beta-galactosidase; n=3; Lactococcus la... 36 0.80 UniRef50_Q2VT50 Cluster: Beta-galactosidase precursor; n=2; Flav... 36 1.1 UniRef50_A4RLN6 Cluster: Putative uncharacterized protein; n=2; ... 35 1.9 UniRef50_O52847 Cluster: Beta-galactosidase; n=3; Bacillus megat... 35 1.9 UniRef50_Q5DC94 Cluster: SJCHGC09076 protein; n=1; Schistosoma j... 34 3.2 UniRef50_Q9K9C6 Cluster: Beta-galactosidase; n=6; Firmicutes|Rep... 34 3.2 UniRef50_Q1NHI7 Cluster: Beta-galactosidase; n=1; Sphingomonas s... 33 4.3 UniRef50_Q28RA2 Cluster: ComEC/Rec2-related protein; n=2; Rhodob... 33 5.7 UniRef50_A4AN51 Cluster: Beta-galactosidase; n=1; Flavobacterial... 33 5.7 UniRef50_Q6CKZ5 Cluster: Kluyveromyces lactis strain NRRL Y-1140... 33 5.7 UniRef50_A6G4K3 Cluster: Putative uncharacterized protein; n=1; ... 33 7.5 UniRef50_UPI0000F1EDC6 Cluster: PREDICTED: hypothetical protein;... 32 9.9 UniRef50_UPI000038DE68 Cluster: COG0457: FOG: TPR repeat; n=1; N... 32 9.9 UniRef50_Q830R3 Cluster: Glycosyl hydrolase, family 2; n=1; Ente... 32 9.9 UniRef50_A6KX57 Cluster: Glycoside hydrolase family 2; n=1; Bact... 32 9.9 UniRef50_Q2UM73 Cluster: Predicted protein; n=7; Trichocomaceae|... 32 9.9 UniRef50_Q96GW7 Cluster: Brevican core protein precursor; n=30; ... 32 9.9 >UniRef50_Q37953 Cluster: LacZ protein; n=1; Phage M13mp18|Rep: LacZ protein - Phage M13mp18 Length = 102 Score = 117 bits (281), Expect = 3e-25 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = +2 Query: 308 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQ 466 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+ Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 78 >UniRef50_P00722 Cluster: Beta-galactosidase; n=35; root|Rep: Beta-galactosidase - Escherichia coli (strain K12) Length = 1024 Score = 117 bits (281), Expect = 3e-25 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = +2 Query: 308 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQ 466 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+ Sbjct: 8 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 >UniRef50_Q8GEG0 Cluster: Putative uncharacterized protein; n=1; Erwinia amylovora|Rep: Putative uncharacterized protein - Erwinia amylovora (Fire blight bacteria) Length = 123 Score = 115 bits (276), Expect = 1e-24 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = +2 Query: 308 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQ 466 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR LNGEW+ Sbjct: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRXLNGEWR 120 >UniRef50_Q47336 Cluster: LacZ-alpha peptide; n=2; cellular organisms|Rep: LacZ-alpha peptide - Escherichia coli Length = 90 Score = 105 bits (252), Expect = 9e-22 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = +2 Query: 308 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 451 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 69 >UniRef50_Q669R9 Cluster: Beta-galactosidase; n=14; Yersinia|Rep: Beta-galactosidase - Yersinia pseudotuberculosis Length = 1066 Score = 76.6 bits (180), Expect = 5e-13 Identities = 32/52 (61%), Positives = 39/52 (75%) Frame = +2 Query: 308 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 463 L +L RRDWENP +TQ +RL AHPPF SWR+ E A+ DRPS Q ++LNG W Sbjct: 15 LPQILSRRDWENPQITQYHRLEAHPPFHSWRDVESAQKDRPSPQQQTLNGLW 66 >UniRef50_UPI0000498F17 Cluster: beta-galactosidase; n=3; Eukaryota|Rep: beta-galactosidase - Entamoeba histolytica HM-1:IMSS Length = 86 Score = 75.8 bits (178), Expect = 8e-13 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +3 Query: 306 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAK 410 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVI++ Sbjct: 5 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVISE 39 Score = 35.5 bits (78), Expect = 1.1 Identities = 17/22 (77%), Positives = 20/22 (90%) Frame = +2 Query: 404 SEEARTDRPSQQLRSLNGEWQI 469 SEEARTDRPSQQLRSL +W++ Sbjct: 38 SEEARTDRPSQQLRSL--KWRM 57 >UniRef50_A7MN76 Cluster: Putative uncharacterized protein; n=1; Enterobacter sakazakii ATCC BAA-894|Rep: Putative uncharacterized protein - Enterobacter sakazakii ATCC BAA-894 Length = 1043 Score = 68.1 bits (159), Expect = 2e-10 Identities = 26/53 (49%), Positives = 36/53 (67%) Frame = +2 Query: 308 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQ 466 LA +L R DW+NP +T +NRL +H P WR+++ AR PS + SL+GEWQ Sbjct: 18 LATILARNDWQNPAITSVNRLPSHTPLHGWRDADRARRGEPSDAVLSLDGEWQ 70 >UniRef50_P06219 Cluster: Beta-galactosidase; n=11; Gammaproteobacteria|Rep: Beta-galactosidase - Klebsiella pneumoniae Length = 1034 Score = 58.4 bits (135), Expect = 1e-07 Identities = 26/47 (55%), Positives = 31/47 (65%) Frame = +2 Query: 317 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 457 VL R DW N +T LNRL AHP FASWR+ AR + PS + R L+G Sbjct: 17 VLAREDWHNQTITHLNRLPAHPVFASWRDELAARDNLPSSRRRQLDG 63 >UniRef50_A0ZLG1 Cluster: Beta-D-galactosidase; n=1; Nodularia spumigena CCY 9414|Rep: Beta-D-galactosidase - Nodularia spumigena CCY 9414 Length = 72 Score = 56.8 bits (131), Expect = 4e-07 Identities = 23/26 (88%), Positives = 26/26 (100%) Frame = +2 Query: 395 WRNSEEARTDRPSQQLRSLNGEWQIV 472 WRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 47 WRNSEEARTDRPSQQLRSLNGEWRLM 72 >UniRef50_P81650 Cluster: Beta-galactosidase; n=26; Gammaproteobacteria|Rep: Beta-galactosidase - Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) Length = 1039 Score = 54.0 bits (124), Expect = 3e-06 Identities = 22/49 (44%), Positives = 34/49 (69%) Frame = +2 Query: 317 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 463 ++ RRDWENP Q+N++ AH P ++ E+AR + SQ+ +SLNG+W Sbjct: 7 IINRRDWENPITVQVNQVKAHSPLNGFKTIEDARENTQSQK-KSLNGQW 54 >UniRef50_A6FJQ2 Cluster: 50S ribosomal protein L5; n=8; Bacteria|Rep: 50S ribosomal protein L5 - Moritella sp. PE36 Length = 45 Score = 51.6 bits (118), Expect = 2e-05 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 472 YNLPFAIQAAQLLGRAIGAGLFAITPAGERG 380 + PFAIQAAQLLGRAIGAGLFAITP E G Sbjct: 8 HQAPFAIQAAQLLGRAIGAGLFAITPEFELG 38 >UniRef50_Q15XN9 Cluster: Glycoside hydrolase family 2, TIM barrel precursor; n=1; Pseudoalteromonas atlantica T6c|Rep: Glycoside hydrolase family 2, TIM barrel precursor - Pseudoalteromonas atlantica (strain T6c / BAA-1087) Length = 1079 Score = 47.6 bits (108), Expect = 2e-04 Identities = 22/48 (45%), Positives = 30/48 (62%), Gaps = 1/48 (2%) Frame = +2 Query: 326 RRDWENPGVTQLNRLAAHPPFASWRNSEEART-DRPSQQLRSLNGEWQ 466 + DWENP V Q+NRL A S+ E+A T DR ++SLNG+W+ Sbjct: 31 KNDWENPDVIQINRLPARATSYSFDTPEQALTRDRNQSTIQSLNGQWK 78 >UniRef50_A6DI70 Cluster: Beta-D-galactosidase; n=1; Lentisphaera araneosa HTCC2155|Rep: Beta-D-galactosidase - Lentisphaera araneosa HTCC2155 Length = 991 Score = 42.7 bits (96), Expect = 0.007 Identities = 20/49 (40%), Positives = 24/49 (48%) Frame = +2 Query: 335 WENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVN 481 WENP LN LA PP S+ + E+A S + SLNG W N Sbjct: 6 WENPQFVSLNTLAPRPPLYSFDSLEKALEQDQSAYIHSLNGSWNFKLFN 54 >UniRef50_Q9JN59 Cluster: Beta-galactosidase; n=16; Vibrio cholerae|Rep: Beta-galactosidase - Vibrio cholerae Length = 56 Score = 42.3 bits (95), Expect = 0.009 Identities = 18/50 (36%), Positives = 30/50 (60%) Frame = +2 Query: 317 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQ 466 +L +DW+NP + + + H P S+R +EAR D + +SLNG+W+ Sbjct: 7 ILLSQDWQNPHIVKWHCRTPHVPLHSYRTEQEARLDVGGNR-QSLNGQWR 55 >UniRef50_A0M224 Cluster: Beta-galactosidase; n=1; Gramella forsetii KT0803|Rep: Beta-galactosidase - Gramella forsetii (strain KT0803) Length = 1049 Score = 42.3 bits (95), Expect = 0.009 Identities = 20/47 (42%), Positives = 27/47 (57%), Gaps = 2/47 (4%) Frame = +2 Query: 332 DWENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEWQ 466 DWENP VT +N+L A S+ N + A S +++SLNG WQ Sbjct: 26 DWENPAVTGINKLPARATMYSFSNKQAAINLNKENSDRVKSLNGTWQ 72 >UniRef50_A0UVE2 Cluster: Glycoside hydrolase family 2, TIM barrel; n=1; Clostridium cellulolyticum H10|Rep: Glycoside hydrolase family 2, TIM barrel - Clostridium cellulolyticum H10 Length = 1033 Score = 41.1 bits (92), Expect = 0.021 Identities = 17/48 (35%), Positives = 31/48 (64%), Gaps = 2/48 (4%) Frame = +2 Query: 329 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDR--PSQQLRSLNGEWQ 466 R+WEN +TQ+NR H P+ ++ + E+A + S+ ++SL+G W+ Sbjct: 3 REWENQYITQINRYPMHSPYGAYESVEQAMSCNRWTSKYVKSLSGIWK 50 >UniRef50_A7LU08 Cluster: Putative uncharacterized protein; n=1; Bacteroides ovatus ATCC 8483|Rep: Putative uncharacterized protein - Bacteroides ovatus ATCC 8483 Length = 1046 Score = 40.3 bits (90), Expect = 0.037 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 2/52 (3%) Frame = +2 Query: 323 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP--SQQLRSLNGEWQIV 472 Q +WENP + N+ H F + +E+A D+P S SLNG W+ + Sbjct: 26 QNNEWENPAKYEWNKERPHADFRLYEQAEDAVNDKPRKSSWQHSLNGVWKFI 77 >UniRef50_Q1II16 Cluster: Glycoside hydrolase family 2, TIM barrel precursor; n=1; Acidobacteria bacterium Ellin345|Rep: Glycoside hydrolase family 2, TIM barrel precursor - Acidobacteria bacterium (strain Ellin345) Length = 1049 Score = 39.1 bits (87), Expect = 0.086 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 2/50 (4%) Frame = +2 Query: 323 QRRDWENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEWQ 466 Q DWENP V +NR A F + + A R ++PS ++SLNG W+ Sbjct: 21 QTPDWENPRVFGINREAPRATFTPFPDEASALKRREQPSVFMQSLNGMWK 70 >UniRef50_Q15NH4 Cluster: Glycoside hydrolase family 2, TIM barrel; n=1; Pseudoalteromonas atlantica T6c|Rep: Glycoside hydrolase family 2, TIM barrel - Pseudoalteromonas atlantica (strain T6c / BAA-1087) Length = 1045 Score = 37.9 bits (84), Expect = 0.20 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = +2 Query: 332 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRP--SQQLRSLNGEW 463 DW+NP V +N+ A F + + + D P SQ SLNGEW Sbjct: 11 DWQNPEVFAINKEPARSSFYGFSDDPQGYVDSPFMSQDYLSLNGEW 56 >UniRef50_A5FCG4 Cluster: Beta-galactosidase precursor; n=1; Flavobacterium johnsoniae UW101|Rep: Beta-galactosidase precursor - Flavobacterium johnsoniae UW101 Length = 1108 Score = 37.5 bits (83), Expect = 0.26 Identities = 18/62 (29%), Positives = 34/62 (54%), Gaps = 1/62 (1%) Frame = +2 Query: 335 WENPGVTQLNRLAAHPPFASWRNSEEA-RTDRPSQQLRSLNGEWQIVSVNILLKFALNFV 511 WE+P +T +NR + S+ + E+A + DR +++ LNG+W L + + +F Sbjct: 57 WEDPTITSINRQPSRATAYSYSSVEDALKGDRTKSRIQMLNGDWDFKYAVNLKEASKDFY 116 Query: 512 KS 517 K+ Sbjct: 117 KN 118 >UniRef50_A7CVC4 Cluster: Beta-galactosidase; n=1; Opitutaceae bacterium TAV2|Rep: Beta-galactosidase - Opitutaceae bacterium TAV2 Length = 1130 Score = 36.7 bits (81), Expect = 0.46 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Frame = +2 Query: 335 WENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR--SLNGEWQ 466 WE P +T LN+L F + + +EAR + + R SLNG WQ Sbjct: 10 WEAPELTSLNKLPPRATFHGFGSVKEARAGKSEKSTRHHSLNGTWQ 55 >UniRef50_A3XMD4 Cluster: Beta-galactosidase; n=1; Leeuwenhoekiella blandensis MED217|Rep: Beta-galactosidase - Leeuwenhoekiella blandensis MED217 Length = 1033 Score = 36.7 bits (81), Expect = 0.46 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 2/67 (2%) Frame = +2 Query: 323 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ--LRSLNGEWQIVSVNILLKF 496 Q+ +WENP + N+ F + +++A+T SQ +SLNG W+ V + Sbjct: 20 QQNEWENPKIIDRNKEEGRASFVLFEKTQKAKTRDASQSQFYKSLNGVWKFDIVKTPAER 79 Query: 497 ALNFVKS 517 +F K+ Sbjct: 80 PTDFYKT 86 >UniRef50_Q8A2G5 Cluster: Beta-galactosidase; n=8; Bacteroidales|Rep: Beta-galactosidase - Bacteroides thetaiotaomicron Length = 1036 Score = 36.3 bits (80), Expect = 0.61 Identities = 15/47 (31%), Positives = 29/47 (61%), Gaps = 2/47 (4%) Frame = +2 Query: 332 DWENPGVTQLNRLAAHPPFASWRNSEEAR--TDRPSQQLRSLNGEWQ 466 +W++P V +NR A H + ++ +++EA+ + SQ +LNG W+ Sbjct: 26 EWKDPEVNSVNRSAMHTNYFAYASADEAKAGSKEDSQNFMTLNGLWK 72 >UniRef50_Q48727 Cluster: Beta-galactosidase; n=3; Lactococcus lactis|Rep: Beta-galactosidase - Lactococcus lactis subsp. lactis (Streptococcus lactis) Length = 998 Score = 35.9 bits (79), Expect = 0.80 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 317 VLQRRDWENPGVTQLNRLAAHPP 385 VL+R+DWENP V+ NRL H P Sbjct: 9 VLERKDWENPVVSNWNRLPMHTP 31 >UniRef50_Q2VT50 Cluster: Beta-galactosidase precursor; n=2; Flavobacterium|Rep: Beta-galactosidase precursor - Flavobacterium sp. 4214 Length = 1046 Score = 35.5 bits (78), Expect = 1.1 Identities = 19/49 (38%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = +2 Query: 326 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTD--RPSQQLRSLNGEWQ 466 R DWENP V Q+NR A F + + A D S SL+G+W+ Sbjct: 28 RNDWENPEVFQINREPARAAFLPFADEASAIADDYTRSPWYMSLDGKWK 76 >UniRef50_A4RLN6 Cluster: Putative uncharacterized protein; n=2; Magnaporthe grisea|Rep: Putative uncharacterized protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 1047 Score = 34.7 bits (76), Expect = 1.9 Identities = 18/46 (39%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +2 Query: 332 DWENPGVTQLNRLAAHPPFASWRNSEEART-DRPSQQLRSLNGEWQ 466 DW N V N L A F S+ + A T DR + SLNG W+ Sbjct: 9 DWSNLAVLHTNALPARAHFYSYASETAALTHDRHQSEYHSLNGTWK 54 >UniRef50_O52847 Cluster: Beta-galactosidase; n=3; Bacillus megaterium|Rep: Beta-galactosidase - Bacillus megaterium Length = 1034 Score = 34.7 bits (76), Expect = 1.9 Identities = 20/47 (42%), Positives = 26/47 (55%), Gaps = 3/47 (6%) Frame = +2 Query: 332 DWEN-PGVTQLNRLAAHPPFASWRNSEEA-RTDRPSQ-QLRSLNGEW 463 +W N P + QLNR AH ++ EEA + DR S +SLNG W Sbjct: 19 EWNNNPEIFQLNRSKAHALLMPYQTVEEALKNDRKSSVYYQSLNGSW 65 >UniRef50_Q5DC94 Cluster: SJCHGC09076 protein; n=1; Schistosoma japonicum|Rep: SJCHGC09076 protein - Schistosoma japonicum (Blood fluke) Length = 109 Score = 33.9 bits (74), Expect = 3.2 Identities = 19/52 (36%), Positives = 28/52 (53%) Frame = +2 Query: 311 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQ 466 A L+RR+ +NPG QLN L A P F +++A +R S+ G+ Q Sbjct: 57 AAFLKRREGKNPGCPQLNPLEALPLFPGGEKTKKAPPNRLSKNWPPPEGQRQ 108 >UniRef50_Q9K9C6 Cluster: Beta-galactosidase; n=6; Firmicutes|Rep: Beta-galactosidase - Bacillus halodurans Length = 1014 Score = 33.9 bits (74), Expect = 3.2 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +2 Query: 350 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQ 466 V +NRL AH + EEA+ + P SLNG W+ Sbjct: 15 VFAVNRLPAHSDHVYYETVEEAKKEPPMSMRHSLNGHWK 53 >UniRef50_Q1NHI7 Cluster: Beta-galactosidase; n=1; Sphingomonas sp. SKA58|Rep: Beta-galactosidase - Sphingomonas sp. SKA58 Length = 1078 Score = 33.5 bits (73), Expect = 4.3 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 3/50 (6%) Frame = +2 Query: 326 RRDWENPGVTQLNRLAAHP---PFASWRNSEEARTDRPSQQLRSLNGEWQ 466 R DWENP V + +L A PF S R++ A S++ SLNG W+ Sbjct: 39 RPDWENPAVFAIGKLPARATAFPFES-RDAALAGDRSRSRRFLSLNGPWK 87 >UniRef50_Q28RA2 Cluster: ComEC/Rec2-related protein; n=2; Rhodobacteraceae|Rep: ComEC/Rec2-related protein - Jannaschia sp. (strain CCS1) Length = 706 Score = 33.1 bits (72), Expect = 5.7 Identities = 17/39 (43%), Positives = 20/39 (51%) Frame = -1 Query: 206 PGGLSSFTRTGGRAKAQPEGAGFANSYPSASKEDLTTQE 90 PGGL T GRA ++P G GF + DL TQE Sbjct: 540 PGGLVGLTTDQGRALSRPRGDGFVAGIWLENDGDLITQE 578 >UniRef50_A4AN51 Cluster: Beta-galactosidase; n=1; Flavobacteriales bacterium HTCC2170|Rep: Beta-galactosidase - Flavobacteriales bacterium HTCC2170 Length = 1126 Score = 33.1 bits (72), Expect = 5.7 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Frame = +2 Query: 332 DWENPGVTQLNRLAAHPPFASWRNSEEART--DRPSQQLRSLNGEW 463 DWENP + +N+L H F +++ E A + S + + LNG W Sbjct: 27 DWENPEIFGINKLEPHAFFIPFQSQESALSFDATRSDRYQLLNGYW 72 >UniRef50_Q6CKZ5 Cluster: Kluyveromyces lactis strain NRRL Y-1140 chromosome F of strain NRRL Y- 1140 of Kluyveromyces lactis; n=1; Kluyveromyces lactis|Rep: Kluyveromyces lactis strain NRRL Y-1140 chromosome F of strain NRRL Y- 1140 of Kluyveromyces lactis - Kluyveromyces lactis (Yeast) (Candida sphaerica) Length = 1322 Score = 33.1 bits (72), Expect = 5.7 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = -3 Query: 513 LTKFNANFNKILTLTICHSPFRLRNCWEGRSVR 415 L K++ N N++L + I H F LR+C+E +R Sbjct: 1136 LKKYDENLNELLKIVIIHEKFILRHCFESIELR 1168 >UniRef50_A6G4K3 Cluster: Putative uncharacterized protein; n=1; Plesiocystis pacifica SIR-1|Rep: Putative uncharacterized protein - Plesiocystis pacifica SIR-1 Length = 531 Score = 32.7 bits (71), Expect = 7.5 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = +3 Query: 330 VTGKTLALPNLIALQHIPLSPAGVIAKRPAPIAL 431 V+G L LP+L+ PL P G++A++ PIAL Sbjct: 64 VSGPNLQLPHLVDELATPLPPTGLLARKMDPIAL 97 >UniRef50_UPI0000F1EDC6 Cluster: PREDICTED: hypothetical protein; n=1; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 195 Score = 32.3 bits (70), Expect = 9.9 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 308 LAVVLQRRDWENP 346 LAVVLQRRDWENP Sbjct: 179 LAVVLQRRDWENP 191 >UniRef50_UPI000038DE68 Cluster: COG0457: FOG: TPR repeat; n=1; Nostoc punctiforme PCC 73102|Rep: COG0457: FOG: TPR repeat - Nostoc punctiforme PCC 73102 Length = 532 Score = 32.3 bits (70), Expect = 9.9 Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = +2 Query: 308 LAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEA 415 + V+L+ DWE P + QL+ L ++ P SW + +EA Sbjct: 96 IPVLLRYADWETPPIDQLSPLPSNRKPIKSWNDRDEA 132 >UniRef50_Q830R3 Cluster: Glycosyl hydrolase, family 2; n=1; Enterococcus faecalis|Rep: Glycosyl hydrolase, family 2 - Enterococcus faecalis (Streptococcus faecalis) Length = 1025 Score = 32.3 bits (70), Expect = 9.9 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = +2 Query: 329 RDWENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEWQIV 472 + WEN V +NRL F+S+ + E A ++ +Q ++LNG W + Sbjct: 2 KTWENYKVDSINRLPGRAHFSSFPSKETALLNENKYTQAYKNLNGCWHFL 51 >UniRef50_A6KX57 Cluster: Glycoside hydrolase family 2; n=1; Bacteroides vulgatus ATCC 8482|Rep: Glycoside hydrolase family 2 - Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) Length = 1076 Score = 32.3 bits (70), Expect = 9.9 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = +2 Query: 332 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ--LRSLNGEWQ 466 DWEN V +NRL + F + E A SQ +SLNG W+ Sbjct: 55 DWENFDVLHINRLPSAANFMGYPTKELALQGDKSQSPYFQSLNGTWK 101 >UniRef50_Q2UM73 Cluster: Predicted protein; n=7; Trichocomaceae|Rep: Predicted protein - Aspergillus oryzae Length = 167 Score = 32.3 bits (70), Expect = 9.9 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +2 Query: 380 PPFASWRNSEEARTDRPSQQLRSLNGE 460 PP +S RN E R ++P+ LR+L+GE Sbjct: 56 PPSSSSRNDESQREEKPAPHLRNLSGE 82 >UniRef50_Q96GW7 Cluster: Brevican core protein precursor; n=30; Eutheria|Rep: Brevican core protein precursor - Homo sapiens (Human) Length = 911 Score = 32.3 bits (70), Expect = 9.9 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = -2 Query: 214 TGGPEAFPVSRGQVGEQRLSQKGRDLLTATRAP 116 TGGPE V RG+ E S+ LL ATRAP Sbjct: 569 TGGPELSGVPRGESEETGSSEGAPSLLPATRAP 601 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 630,625,444 Number of Sequences: 1657284 Number of extensions: 13057267 Number of successful extensions: 33740 Number of sequences better than 10.0: 40 Number of HSP's better than 10.0 without gapping: 32719 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33722 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 46466611856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -