BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0119 (629 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC926.09c |fas1||fatty acid synthase beta subunit Fas1|Schizos... 28 1.3 SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr... 27 3.0 SPCC1223.01 ||SPCC285.18|ubiquitin-protein ligase E3 |Schizosacc... 27 3.0 SPCC1393.07c |mug4||sequence orphan|Schizosaccharomyces pombe|ch... 26 5.2 >SPAC926.09c |fas1||fatty acid synthase beta subunit Fas1|Schizosaccharomyces pombe|chr 1|||Manual Length = 2073 Score = 27.9 bits (59), Expect = 1.3 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -1 Query: 155 PEGAGFANSYPSASKEDLTTQE 90 P A F ++YP AS +DL TQ+ Sbjct: 980 PVAARFLDAYPEASTQDLNTQD 1001 >SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1275 Score = 26.6 bits (56), Expect = 3.0 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 5/63 (7%) Frame = +3 Query: 273 PIRPIVSRITIHWPSFYNVVTGKTLALPNLIALQ-----HIPLSPAGVIAKRPAPIALPN 437 P P+ S ++ H + + +L N I+L ++PLSP A+ P+PI L + Sbjct: 172 PRPPLPSSVSSHSSPYSTTSSTSLYSLYNDISLSCSPEPYLPLSPTRSPARTPSPIRLYS 231 Query: 438 SCA 446 S A Sbjct: 232 SDA 234 >SPCC1223.01 ||SPCC285.18|ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 732 Score = 26.6 bits (56), Expect = 3.0 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +2 Query: 380 PPFASWRNSEEARTDRPSQQLRSLN 454 PP AS RN E + PS+Q S+N Sbjct: 353 PPGASGRNRRERTSSTPSEQSTSVN 377 >SPCC1393.07c |mug4||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 845 Score = 25.8 bits (54), Expect = 5.2 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = -1 Query: 314 RPVNCNTTHYRANWVPGPPSAAADRFFFLRLRVYWWP 204 R +N T +W P PP + LRLR+Y+ P Sbjct: 277 RSLNDATNMETYHWSPFPPQFSTFNDNALRLRIYYKP 313 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,479,179 Number of Sequences: 5004 Number of extensions: 48762 Number of successful extensions: 99 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 99 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 99 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 279695522 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -