BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0119 (629 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0294 + 22022630-22024006,22024109-22024234,22024319-220244... 30 1.3 11_06_0278 - 21854859-21855101,21855529-21855587,21855684-218557... 30 1.3 09_02_0036 + 3217163-3217584,3217752-3218322 30 1.3 03_05_1097 + 30393336-30393578,30393661-30393780,30393859-303940... 29 3.0 06_01_0092 - 775290-775691 28 7.0 06_03_0865 - 25516072-25517007 27 9.3 04_01_0312 + 4206400-4206627,4206661-4207269,4207425-4207902,420... 27 9.3 >11_06_0294 + 22022630-22024006,22024109-22024234,22024319-22024423, 22024525-22024659,22024798-22024847,22026487-22026545, 22026819-22026928,22027941-22028174,22028278-22028377, 22028699-22028829,22029834-22029914,22029970-22030128 Length = 888 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +2 Query: 359 LNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNILLKFAL 502 L+R + PF SW N +A D+ + L LNG + + LK L Sbjct: 399 LSRPSRQDPFTSWDNMRQACLDKGTHALGKLNGRAAALIEKVNLKRGL 446 >11_06_0278 - 21854859-21855101,21855529-21855587,21855684-21855711, 21855812-21856702,21856792-21857011,21857638-21857687, 21863174-21863284,21863379-21863483,21863568-21863693, 21863796-21865187 Length = 1074 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +2 Query: 359 LNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNILLKFAL 502 L+R + PF SW N +A D+ + L LNG + + LK L Sbjct: 404 LSRPSRQDPFTSWDNMRQACLDKGTHALGKLNGRAAALIEKVNLKRGL 451 >09_02_0036 + 3217163-3217584,3217752-3218322 Length = 330 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/28 (46%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +3 Query: 297 ITIHWPSFYNVV-TGKTLALPNLIALQH 377 I+ W F N+V +G TL++PN + LQH Sbjct: 69 ISAGWSRFINLVQSGPTLSIPNYVLLQH 96 >03_05_1097 + 30393336-30393578,30393661-30393780,30393859-30394017, 30394184-30394225,30394336-30394508,30394600-30394705, 30394795-30394824 Length = 290 Score = 29.1 bits (62), Expect = 3.0 Identities = 12/29 (41%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Frame = -1 Query: 605 WNNTQPLSRSILLIYKGFCRI--SAYWLK 525 W+ T P+S +L +KGFC + +AY+ K Sbjct: 214 WSTTPPVSADVLHQWKGFCALIANAYYTK 242 >06_01_0092 - 775290-775691 Length = 133 Score = 27.9 bits (59), Expect = 7.0 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -3 Query: 417 RASSLLRQLAKGGCAARR 364 RA+SLLRQL + GCAA + Sbjct: 22 RAASLLRQLIEDGCAAAK 39 >06_03_0865 - 25516072-25517007 Length = 311 Score = 27.5 bits (58), Expect = 9.3 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = -3 Query: 210 VARRPFQFHEDRWASKGSARRGGIC*QLPERLQGRPNNS 94 V RRPF ED + AR G + LQGR +N+ Sbjct: 65 VERRPFTAEEDATILRAHARLGNRWAAIARLLQGRTDNA 103 >04_01_0312 + 4206400-4206627,4206661-4207269,4207425-4207902, 4208006-4208297,4209278-4209569,4210013-4210465 Length = 783 Score = 27.5 bits (58), Expect = 9.3 Identities = 12/24 (50%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = +3 Query: 309 WPSFYNVV-TGKTLALPNLIALQH 377 W F N+V +G TL+LP + LQH Sbjct: 133 WSRFTNLVQSGPTLSLPEYVLLQH 156 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,415,287 Number of Sequences: 37544 Number of extensions: 387777 Number of successful extensions: 1081 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1056 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1080 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1537558360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -