BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0118 (762 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g13990.1 68418.m01636 exocyst subunit EXO70 family protein co... 29 4.5 At5g35810.1 68418.m04303 hypothetical protein 28 7.8 >At5g13990.1 68418.m01636 exocyst subunit EXO70 family protein contains Pfam domain PF03081: Exo70 exocyst complex subunit; Length = 695 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/50 (26%), Positives = 26/50 (52%), Gaps = 4/50 (8%) Frame = +3 Query: 600 ILNNNNYVHRARRSAA----ILN*KWRRTPTKKAHLFRKNYRLEKWGYLV 737 ++NN Y+ + + +A ++ W R + + + KNY+ E WG L+ Sbjct: 531 MMNNGRYIVQKIKGSAEIHEVMGDTWCRRRSSELRNYHKNYQRETWGKLL 580 >At5g35810.1 68418.m04303 hypothetical protein Length = 347 Score = 27.9 bits (59), Expect = 7.8 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 2/31 (6%) Frame = +1 Query: 436 MIYTVEYKLQ--FINIPINKHSKLFNRKNEI 522 +I+TV++K Q F IN+H K+FNR E+ Sbjct: 57 LIWTVDHKNQSLFHIAAINRHEKIFNRIYEL 87 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,925,331 Number of Sequences: 28952 Number of extensions: 252467 Number of successful extensions: 472 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 464 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 472 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1702303248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -