BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0117 (690 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g09810.1 68418.m01135 actin 7 (ACT7) / actin 2 identical to S... 147 5e-36 At3g53750.1 68416.m05938 actin 3 (ACT3) identical to SP|P53493 A... 147 5e-36 At3g12110.1 68416.m01507 actin 11 (ACT11) identical to SP|P53496... 147 5e-36 At2g37620.1 68415.m04615 actin 1 (ACT1) identical to SP|P10671 A... 147 5e-36 At3g18780.2 68416.m02386 actin 2 (ACT2) identical to SP|Q96292 A... 144 5e-35 At1g49240.1 68414.m05520 actin 8 (ACT8) identical to SP|Q96293 A... 144 5e-35 At5g59370.1 68418.m07440 actin 4 (ACT4) identical to SP|P53494 A... 142 2e-34 At3g46520.1 68416.m05050 actin 12 (ACT12) identical to SP|P53497... 142 2e-34 At2g42100.1 68415.m05205 actin, putative very strong similarity ... 130 8e-31 At2g42170.1 68415.m05219 actin, putative similar to actin 2 [Ara... 123 1e-28 At2g42090.1 68415.m05204 actin, putative similar to SP|P53496 Ac... 112 2e-25 At3g18780.1 68416.m02385 actin 2 (ACT2) identical to SP|Q96292 A... 103 1e-22 At1g18450.1 68414.m02302 actin-related protein 4 (ARP4) neary id... 81 9e-16 At3g60830.1 68416.m06805 actin-related protein 7 (ARP7) identica... 72 4e-13 At3g33520.1 68416.m04291 actin-related protein 6 (ARP6) nearly i... 57 1e-08 At3g27000.1 68416.m03378 actin-related protein 2 (ARP2) nearly i... 50 2e-06 At1g13180.1 68414.m01528 actin-related protein 3 (ARP3) identica... 43 2e-04 At5g56180.1 68418.m07008 actin-related protein, putative (ARP8) ... 39 0.004 At3g12380.1 68416.m01543 actin/actin-like family protein similar... 34 0.10 At1g69270.1 68414.m07941 leucine-rich repeat family protein / pr... 30 1.3 At5g46330.1 68418.m05703 leucine-rich repeat transmembrane prote... 30 1.7 At4g10780.1 68417.m01758 disease resistance protein (CC-NBS-LRR ... 29 3.8 At2g39440.1 68415.m04841 expressed protein 29 3.8 At4g30340.1 68417.m04312 diacylglycerol kinase family protein co... 28 5.1 At4g00750.1 68417.m00102 dehydration-responsive family protein s... 28 5.1 At1g20950.1 68414.m02623 pyrophosphate--fructose-6-phosphate 1-p... 28 5.1 At2g26340.1 68415.m03160 expressed protein 28 6.7 At2g18730.1 68415.m02181 diacylglycerol kinase, putative contain... 28 6.7 At1g16610.2 68414.m01990 arginine/serine-rich protein, putative ... 28 6.7 At1g16610.1 68414.m01989 arginine/serine-rich protein, putative ... 28 6.7 At2g42760.1 68415.m05295 expressed protein 27 8.9 At2g27610.1 68415.m03349 pentatricopeptide (PPR) repeat-containi... 27 8.9 At2g11090.1 68415.m01187 expressed protein 27 8.9 At1g03560.1 68414.m00337 pentatricopeptide (PPR) repeat-containi... 27 8.9 >At5g09810.1 68418.m01135 actin 7 (ACT7) / actin 2 identical to SP|P53492 Actin 7 (Actin-2) {Arabidopsis thaliana} Length = 377 Score = 147 bits (357), Expect = 5e-36 Identities = 66/73 (90%), Positives = 71/73 (97%) Frame = -3 Query: 508 TTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEY 329 +TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EY Sbjct: 305 STMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKSEY 364 Query: 328 DESGPSIVHRKCF 290 DESGPSIVHRKCF Sbjct: 365 DESGPSIVHRKCF 377 Score = 64.9 bits (151), Expect = 5e-11 Identities = 33/54 (61%), Positives = 36/54 (66%) Frame = -1 Query: 669 IGKRKIPLPKGFLPNPRFWVWKLAGIHETTYNSIMKCDVDIRKDLYANTVLSGG 508 IG + P+ L P + GIHETTYNSIMKCDVDIRKDLY N VLSGG Sbjct: 252 IGAERFRCPE-VLFQPSLIGMEAPGIHETTYNSIMKCDVDIRKDLYGNIVLSGG 304 >At3g53750.1 68416.m05938 actin 3 (ACT3) identical to SP|P53493 Actin 3 {Arabidopsis thaliana}; supported by full-length cDNA: Ceres: 19581. Length = 377 Score = 147 bits (357), Expect = 5e-36 Identities = 66/73 (90%), Positives = 71/73 (97%) Frame = -3 Query: 508 TTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEY 329 TTM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWI+K EY Sbjct: 305 TTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIAKAEY 364 Query: 328 DESGPSIVHRKCF 290 DESGPSIVHRKCF Sbjct: 365 DESGPSIVHRKCF 377 Score = 66.9 bits (156), Expect = 1e-11 Identities = 34/54 (62%), Positives = 37/54 (68%) Frame = -1 Query: 669 IGKRKIPLPKGFLPNPRFWVWKLAGIHETTYNSIMKCDVDIRKDLYANTVLSGG 508 IG + P+ L P + AGIHETTYNSIMKCDVDIRKDLY N VLSGG Sbjct: 252 IGSERFRCPE-VLYQPSMIGMENAGIHETTYNSIMKCDVDIRKDLYGNIVLSGG 304 >At3g12110.1 68416.m01507 actin 11 (ACT11) identical to SP|P53496 Actin 11 {Arabidopsis thaliana} Length = 377 Score = 147 bits (357), Expect = 5e-36 Identities = 66/73 (90%), Positives = 71/73 (97%) Frame = -3 Query: 508 TTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEY 329 TTM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWI+K EY Sbjct: 305 TTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIAKAEY 364 Query: 328 DESGPSIVHRKCF 290 DESGPSIVHRKCF Sbjct: 365 DESGPSIVHRKCF 377 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 37/54 (68%) Frame = -1 Query: 669 IGKRKIPLPKGFLPNPRFWVWKLAGIHETTYNSIMKCDVDIRKDLYANTVLSGG 508 IG + P+ L P + AGIHETTYNSIMKCDVDIRKDLY N VLSGG Sbjct: 252 IGGERFRCPE-VLFQPSLVGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGG 304 >At2g37620.1 68415.m04615 actin 1 (ACT1) identical to SP|P10671 Actin 1 (Actin 3) {Arabidopsis thaliana} Length = 377 Score = 147 bits (357), Expect = 5e-36 Identities = 66/73 (90%), Positives = 71/73 (97%) Frame = -3 Query: 508 TTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEY 329 TTM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWI+K EY Sbjct: 305 TTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIAKAEY 364 Query: 328 DESGPSIVHRKCF 290 DESGPSIVHRKCF Sbjct: 365 DESGPSIVHRKCF 377 Score = 66.9 bits (156), Expect = 1e-11 Identities = 34/54 (62%), Positives = 37/54 (68%) Frame = -1 Query: 669 IGKRKIPLPKGFLPNPRFWVWKLAGIHETTYNSIMKCDVDIRKDLYANTVLSGG 508 IG + P+ L P + AGIHETTYNSIMKCDVDIRKDLY N VLSGG Sbjct: 252 IGSERFRCPE-VLYQPSMIGMENAGIHETTYNSIMKCDVDIRKDLYGNIVLSGG 304 >At3g18780.2 68416.m02386 actin 2 (ACT2) identical to SP|Q96292 Actin 2 {Arabidopsis thaliana}; nearly identical to SP|Q96293 Actin 8 [Arabidopsis thaliana] GI:1669387 and to At1g49240 Length = 377 Score = 144 bits (349), Expect = 5e-35 Identities = 75/117 (64%), Positives = 89/117 (76%), Gaps = 4/117 (3%) Frame = -3 Query: 628 KPSFLGMEACG-HPRDHI*LHH---EVRRGHP*GLVRQHRIVRWTTMYPGIADRMQKEIT 461 +PSF+GMEA G H + + ++R+ +V + TTM+ GIADRM KEIT Sbjct: 265 QPSFVGMEAAGIHETTYNSIMKCDVDIRKDLYGNIV----LSGGTTMFSGIADRMSKEIT 320 Query: 460 ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 290 ALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDE+GP IVHRKCF Sbjct: 321 ALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKAEYDEAGPGIVHRKCF 377 Score = 69.3 bits (162), Expect = 2e-12 Identities = 35/54 (64%), Positives = 38/54 (70%) Frame = -1 Query: 669 IGKRKIPLPKGFLPNPRFWVWKLAGIHETTYNSIMKCDVDIRKDLYANTVLSGG 508 IG + P+ L P F + AGIHETTYNSIMKCDVDIRKDLY N VLSGG Sbjct: 252 IGAERFRCPE-VLFQPSFVGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGG 304 >At1g49240.1 68414.m05520 actin 8 (ACT8) identical to SP|Q96293 Actin 8 {Arabidopsis thaliana}; nearly identical to SP|Q96292 Actin 2 [Arabidopsis thaliana] GI:1669387, and to At3g18780 Length = 377 Score = 144 bits (349), Expect = 5e-35 Identities = 75/117 (64%), Positives = 89/117 (76%), Gaps = 4/117 (3%) Frame = -3 Query: 628 KPSFLGMEACG-HPRDHI*LHH---EVRRGHP*GLVRQHRIVRWTTMYPGIADRMQKEIT 461 +PSF+GMEA G H + + ++R+ +V + TTM+ GIADRM KEIT Sbjct: 265 QPSFVGMEAAGIHETTYNSIMKCDVDIRKDLYGNIV----LSGGTTMFSGIADRMSKEIT 320 Query: 460 ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 290 ALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDE+GP IVHRKCF Sbjct: 321 ALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKAEYDEAGPGIVHRKCF 377 Score = 69.3 bits (162), Expect = 2e-12 Identities = 35/54 (64%), Positives = 38/54 (70%) Frame = -1 Query: 669 IGKRKIPLPKGFLPNPRFWVWKLAGIHETTYNSIMKCDVDIRKDLYANTVLSGG 508 IG + P+ L P F + AGIHETTYNSIMKCDVDIRKDLY N VLSGG Sbjct: 252 IGAERFRCPE-VLFQPSFVGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGG 304 >At5g59370.1 68418.m07440 actin 4 (ACT4) identical to SP|P53494 Actin 4 {Arabidopsis thaliana} Length = 377 Score = 142 bits (344), Expect = 2e-34 Identities = 64/73 (87%), Positives = 69/73 (94%) Frame = -3 Query: 508 TTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEY 329 TTM+ GI DRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWI+K EY Sbjct: 305 TTMFGGIGDRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIAKAEY 364 Query: 328 DESGPSIVHRKCF 290 DESGPSIVHRKCF Sbjct: 365 DESGPSIVHRKCF 377 Score = 64.1 bits (149), Expect = 8e-11 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -1 Query: 597 GIHETTYNSIMKCDVDIRKDLYANTVLSGG 508 GIHETTYNSIMKCDVDIRKDLY N VLSGG Sbjct: 275 GIHETTYNSIMKCDVDIRKDLYGNIVLSGG 304 >At3g46520.1 68416.m05050 actin 12 (ACT12) identical to SP|P53497 Actin 12 {Arabidopsis thaliana} Length = 377 Score = 142 bits (344), Expect = 2e-34 Identities = 64/73 (87%), Positives = 69/73 (94%) Frame = -3 Query: 508 TTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEY 329 TTM+ GI DRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWI+K EY Sbjct: 305 TTMFGGIGDRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIAKAEY 364 Query: 328 DESGPSIVHRKCF 290 DESGPSIVHRKCF Sbjct: 365 DESGPSIVHRKCF 377 Score = 64.1 bits (149), Expect = 8e-11 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -1 Query: 597 GIHETTYNSIMKCDVDIRKDLYANTVLSGG 508 GIHETTYNSIMKCDVDIRKDLY N VLSGG Sbjct: 275 GIHETTYNSIMKCDVDIRKDLYGNIVLSGG 304 >At2g42100.1 68415.m05205 actin, putative very strong similarity to SP|P53496 Actin 11 {Arabidopsis thaliana}, SP|P53493 Actin 3 {Arabidopsis thaliana}; contains Pfam profile PF00022: Actin Length = 378 Score = 130 bits (314), Expect = 8e-31 Identities = 57/73 (78%), Positives = 65/73 (89%) Frame = -3 Query: 508 TTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEY 329 TTM+PGIADRM KEI ALAP +MKIK++APPERKYSVW+GGSILASLS+F MWI+K EY Sbjct: 306 TTMFPGIADRMNKEINALAPPSMKIKVVAPPERKYSVWVGGSILASLSSFAPMWITKAEY 365 Query: 328 DESGPSIVHRKCF 290 DE G +IVHRKCF Sbjct: 366 DEQGGAIVHRKCF 378 Score = 64.5 bits (150), Expect = 6e-11 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 600 AGIHETTYNSIMKCDVDIRKDLYANTVLSGG 508 +GIHETTYNSIMKCDVDIRKDLY N VLSGG Sbjct: 275 SGIHETTYNSIMKCDVDIRKDLYGNIVLSGG 305 >At2g42170.1 68415.m05219 actin, putative similar to actin 2 [Arabidopsis thaliana] gi|9293903|dbj|BAB01806 Length = 329 Score = 123 bits (297), Expect = 1e-28 Identities = 54/73 (73%), Positives = 65/73 (89%) Frame = -3 Query: 508 TTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEY 329 TTM+ GI +RM KEI ALA + M+IKI+APPERKYSVWIGGSILASLST++QMWI+K EY Sbjct: 257 TTMFRGIEERMTKEINALAAANMRIKIVAPPERKYSVWIGGSILASLSTYEQMWITKAEY 316 Query: 328 DESGPSIVHRKCF 290 +E+GP+IVH KCF Sbjct: 317 EENGPAIVHTKCF 329 Score = 60.5 bits (140), Expect = 1e-09 Identities = 31/54 (57%), Positives = 35/54 (64%) Frame = -1 Query: 669 IGKRKIPLPKGFLPNPRFWVWKLAGIHETTYNSIMKCDVDIRKDLYANTVLSGG 508 IG + P+ L P + +GIHE TYNSIMKCD DIRKDLY N VLSGG Sbjct: 204 IGAERFRCPE-VLFQPSLIGMETSGIHEKTYNSIMKCDDDIRKDLYGNIVLSGG 256 >At2g42090.1 68415.m05204 actin, putative similar to SP|P53496 Actin 11 {Arabidopsis thaliana}; contains Pfam profile PF00022: Actin Length = 366 Score = 112 bits (269), Expect = 2e-25 Identities = 49/72 (68%), Positives = 59/72 (81%) Frame = -3 Query: 508 TTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEY 329 TTM GI +RM KE+ AL PS+MK+K++ PPE + SVWIGGSILASLSTF QMWI+K EY Sbjct: 294 TTMLHGIKERMTKELNALVPSSMKVKVVVPPESECSVWIGGSILASLSTFHQMWITKDEY 353 Query: 328 DESGPSIVHRKC 293 +E G +IVHRKC Sbjct: 354 EEHGAAIVHRKC 365 Score = 47.6 bits (108), Expect = 8e-06 Identities = 18/31 (58%), Positives = 25/31 (80%) Frame = -1 Query: 600 AGIHETTYNSIMKCDVDIRKDLYANTVLSGG 508 +GIHE T NSI+KC VD R+D+Y N +++GG Sbjct: 263 SGIHEATRNSILKCPVDTRRDMYGNILMTGG 293 >At3g18780.1 68416.m02385 actin 2 (ACT2) identical to SP|Q96292 Actin 2 {Arabidopsis thaliana}; nearly identical to SP|Q96293 Actin 8 [Arabidopsis thaliana] GI:1669387 and to At1g49240 Length = 371 Score = 103 bits (246), Expect = 1e-22 Identities = 58/101 (57%), Positives = 73/101 (72%), Gaps = 4/101 (3%) Frame = -3 Query: 628 KPSFLGMEACG-HPRDHI*LHH---EVRRGHP*GLVRQHRIVRWTTMYPGIADRMQKEIT 461 +PSF+GMEA G H + + ++R+ +V + TTM+ GIADRM KEIT Sbjct: 265 QPSFVGMEAAGIHETTYNSIMKCDVDIRKDLYGNIV----LSGGTTMFSGIADRMSKEIT 320 Query: 460 ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK 338 ALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQ+ I + Sbjct: 321 ALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQVKIDQ 361 Score = 69.3 bits (162), Expect = 2e-12 Identities = 35/54 (64%), Positives = 38/54 (70%) Frame = -1 Query: 669 IGKRKIPLPKGFLPNPRFWVWKLAGIHETTYNSIMKCDVDIRKDLYANTVLSGG 508 IG + P+ L P F + AGIHETTYNSIMKCDVDIRKDLY N VLSGG Sbjct: 252 IGAERFRCPE-VLFQPSFVGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGG 304 >At1g18450.1 68414.m02302 actin-related protein 4 (ARP4) neary identical to actin-related protein 4 (ARP4) [Arabidopsis thaliana] GI:21427463; contains Pfam profile PF00022: Actin; supporting cDNA gi|21427462|gb|AF507912.1| Length = 441 Score = 80.6 bits (190), Expect = 9e-16 Identities = 35/75 (46%), Positives = 53/75 (70%), Gaps = 3/75 (4%) Frame = -3 Query: 508 TTMYPGIADRMQKEITALAPSTMKIKIIAP---PERKYSVWIGGSILASLSTFQQMWISK 338 T+ + +R++K++ +P + ++K++A ER++SVWIGGSILASL +FQQMW SK Sbjct: 366 TSSMQQLKERLEKDLIEESPHSARVKVLASGNTTERRFSVWIGGSILASLGSFQQMWFSK 425 Query: 337 QEYDESGPSIVHRKC 293 EY+E G S + RKC Sbjct: 426 SEYEEHGASYIQRKC 440 Score = 37.5 bits (83), Expect = 0.008 Identities = 15/30 (50%), Positives = 22/30 (73%) Frame = -1 Query: 597 GIHETTYNSIMKCDVDIRKDLYANTVLSGG 508 G+ SI KCDVDIR++LY++ +L+GG Sbjct: 336 GLPHMVMESINKCDVDIRRELYSSILLAGG 365 >At3g60830.1 68416.m06805 actin-related protein 7 (ARP7) identical to actin-related protein 7 (ARP7) [Arabidopsis thaliana] GI:21427469; contains Pfam profile PF00022: Actin Length = 363 Score = 71.7 bits (168), Expect = 4e-13 Identities = 47/137 (34%), Positives = 70/137 (51%), Gaps = 6/137 (4%) Frame = -3 Query: 682 RVIPHRKTKDSVAKRLSSKPSFLGMEACGHPRDHI*LHHEVRRGHP*GLVRQHRIVRWTT 503 +VI + + SV + L +PS LG+E G + + V + L+ + TT Sbjct: 229 QVISIGRERYSVGEALF-QPSILGLEEHGIVEQLVRIISTVSSENHRQLLENTVLCGGTT 287 Query: 502 MYPGIADRMQKEITALAPSTMKIKIIAPPERK------YSVWIGGSILASLSTFQQMWIS 341 G R QKE L S ++ ++ PPE YS W+GG+ILA + Q ++ Sbjct: 288 SMTGFESRFQKEAN-LCSSAIRPTLVKPPEYMPENLGMYSAWVGGAILAKVVFPQNQHVT 346 Query: 340 KQEYDESGPSIVHRKCF 290 K +YDE+GPS+VHRKCF Sbjct: 347 KADYDETGPSVVHRKCF 363 >At3g33520.1 68416.m04291 actin-related protein 6 (ARP6) nearly identical to actin-related protein 6 (ARP6) [Arabidopsis thaliana] GI:21427467; contains Pfam profile PF00022: Actin Length = 421 Score = 56.8 bits (131), Expect = 1e-08 Identities = 25/73 (34%), Positives = 42/73 (57%) Frame = -3 Query: 508 TTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEY 329 +T++P + +R++ E+ L P +KI + VW GGS+LAS F+ M ++K EY Sbjct: 348 STLFPQLKERLEGELRPLVPDHFDVKITTQEDPILGVWRGGSLLASSPDFESMCVTKAEY 407 Query: 328 DESGPSIVHRKCF 290 +E G + R+ F Sbjct: 408 EELGSARCRRRFF 420 >At3g27000.1 68416.m03378 actin-related protein 2 (ARP2) nearly identical to actin-related protein 2 (ARP2) [Arabidopsis thaliana] GI:3818624; contains Pfam profile PF00022: Actin Length = 389 Score = 49.6 bits (113), Expect = 2e-06 Identities = 28/93 (30%), Positives = 56/93 (60%), Gaps = 13/93 (13%) Frame = -3 Query: 538 LVRQHRIVRW-TTMYPGIADRMQKEI------TALAPST-----MKIKIIAPPERKYSVW 395 ++ QH ++ +TMYPG+ R++KEI T L + ++++I PP RK+ V+ Sbjct: 293 MLYQHIVLSGGSTMYPGLPSRLEKEIQDRYLDTVLKGNKDGLKKLRLRIEDPPRRKHMVY 352 Query: 394 IGGSILAS-LSTFQQMWISKQEYDESGPSIVHR 299 +GG++LA + + WI++++Y E G + +++ Sbjct: 353 LGGAVLAGIMKDAPEFWINREDYMEEGINCLNK 385 Score = 27.9 bits (59), Expect = 6.7 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -1 Query: 597 GIHETTYNSIMKCDVDIRKDLYANTVLSGG 508 G+ + + I + D+D R LY + VLSGG Sbjct: 274 GMADMVFRCIQEMDIDNRMMLYQHIVLSGG 303 >At1g13180.1 68414.m01528 actin-related protein 3 (ARP3) identical to actin-related protein 3 (ARP3) [Arabidopsis thaliana] GI:21427461; contains Pfam profile PF00022: Actin Length = 427 Score = 42.7 bits (96), Expect = 2e-04 Identities = 16/45 (35%), Positives = 31/45 (68%) Frame = -3 Query: 442 MKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSI 308 +++ +++ P ++++VW GGS+L+S F +K+EY+E G SI Sbjct: 372 VEVNVVSHPVQRFAVWFGGSVLSSTPEFFASCRTKEEYEEYGASI 416 >At5g56180.1 68418.m07008 actin-related protein, putative (ARP8) strong similarity to actin-related protein 8A (ARP8) [Arabidopsis thaliana] GI:21427473; contains Pfam profile PF00022: Actin; supporting cDNA gi|21427470|gb|AF507916.1| Length = 471 Score = 38.7 bits (86), Expect = 0.004 Identities = 17/59 (28%), Positives = 38/59 (64%), Gaps = 3/59 (5%) Frame = -3 Query: 496 PGIADRMQKEITALAPSTMK--IKIIAPPERKYSVWIGGSILASLSTFQQMW-ISKQEY 329 PG+++R+++E+ PS++ I++I PP + W G ++++LS F W I+++++ Sbjct: 405 PGLSERLERELQDHLPSSISNGIRVIPPPYGVDTSWHGAKLISNLSIFPGPWCITRKQF 463 >At3g12380.1 68416.m01543 actin/actin-like family protein similar to SP|P53946 Actin-like protein ARP5 {Saccharomyces cerevisiae}; contains Pfam profile PF00022: Actin Length = 724 Score = 33.9 bits (74), Expect = 0.10 Identities = 16/63 (25%), Positives = 29/63 (46%) Frame = -3 Query: 505 TMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYD 326 ++ PG+ +R++ I + P I ++ + W G S A+ F +K +YD Sbjct: 648 SLLPGMNERLECGIRMIRPCGSPINVVRAMDPVLDAWRGASAFAANLNFLGNAFTKMDYD 707 Query: 325 ESG 317 E G Sbjct: 708 EKG 710 >At1g69270.1 68414.m07941 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 540 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = +2 Query: 392 DPYGVLPLWRSNDLNLHCRW-GESCD 466 DP GVL W S+ + HC W G SC+ Sbjct: 45 DPNGVLSSWVSDSSSNHCSWYGVSCN 70 >At5g46330.1 68418.m05703 leucine-rich repeat transmembrane protein kinase, putative Length = 1173 Score = 29.9 bits (64), Expect = 1.7 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +2 Query: 386 STDPYGVLPLWRSNDLNLHCRW-GESCDFLLHTVGDS 493 S DP GVL W HC W G +CD H V S Sbjct: 42 SNDPLGVLSDWTIIGSLRHCNWTGITCDSTGHVVSVS 78 >At4g10780.1 68417.m01758 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 892 Score = 28.7 bits (61), Expect = 3.8 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 4/45 (8%) Frame = +1 Query: 448 MGREL*FPFAYGRRFQGTWWSTGQYGVG----VQVLTDVHVALHD 570 MGRE F A+ R + G YG+G +LT +H LHD Sbjct: 155 MGRETIFQRAWNRLMDDGVGTMGLYGMGGVGKTTLLTQIHNTLHD 199 >At2g39440.1 68415.m04841 expressed protein Length = 773 Score = 28.7 bits (61), Expect = 3.8 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +2 Query: 341 RDP-HLLEGREGGEDRSTDPYGVLPLWRSNDLNLHCRWGESCD 466 R+P G E GEDR DP + + R NDL + + + D Sbjct: 39 REPGEFAAGMEEGEDRPIDPISDIDITRINDLMFNSNFRAAAD 81 >At4g30340.1 68417.m04312 diacylglycerol kinase family protein contains INTERPRO domain, IPR001206, DAG-kinase catalytic domain Length = 374 Score = 28.3 bits (60), Expect = 5.1 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +2 Query: 395 PYGVLPLWRSNDLNLHCRWGESCDFLLHTVGDSRVH 502 P GV+PL NDL+ WG S F + +H Sbjct: 192 PVGVIPLGTGNDLSRSFSWGGSFPFAWRSAMKRTLH 227 >At4g00750.1 68417.m00102 dehydration-responsive family protein similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 633 Score = 28.3 bits (60), Expect = 5.1 Identities = 10/37 (27%), Positives = 23/37 (62%) Frame = -2 Query: 431 DHCSSREEVLRMDRWIDPRLPLYLPTNVDLETRVRRV 321 D C + +L MDR + P+ + + ++D+ T+V+++ Sbjct: 555 DRCDMEDILLEMDRILRPKGSVIIRDDIDVLTKVKKI 591 >At1g20950.1 68414.m02623 pyrophosphate--fructose-6-phosphate 1-phosphotransferase-related / pyrophosphate-dependent 6-phosphofructose-1-kinase-related similar to pyrophosphate--fructose 6-phosphate 1-phosphotransferase alpha subunit SP:Q41140 from [Ricinus communis] Length = 614 Score = 28.3 bits (60), Expect = 5.1 Identities = 12/42 (28%), Positives = 19/42 (45%) Frame = +2 Query: 449 WGESCDFLLHTVGDSRVHGGPPDNTVLAYKSLRMSTSHFMME 574 W + + L ++G +H D AY LR + F+ME Sbjct: 493 WSQDASYTLTSIGRPAIHPAMVDLKGKAYDLLRQNAQKFLME 534 >At2g26340.1 68415.m03160 expressed protein Length = 230 Score = 27.9 bits (59), Expect = 6.7 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = -1 Query: 333 STTSLAPPLYTGSASKRTARRCLQQPGPAAQFRLVISVNLIVRKILL 193 +T SL PL++ S K+ P P Q R VISV+ + ++LL Sbjct: 6 ATVSL--PLFSNSNHKKLTCAATLSPPPWKQSRRVISVSFFLSRLLL 50 >At2g18730.1 68415.m02181 diacylglycerol kinase, putative contains INTERPRO domain, IPR001206, DAG-kinase catalytic domain Length = 488 Score = 27.9 bits (59), Expect = 6.7 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +2 Query: 395 PYGVLPLWRSNDLNLHCRWGESCDFLLHTVGDSRVH 502 P GV+PL NDL+ WG S F + +H Sbjct: 189 PVGVIPLGTGNDLSRSFGWGGSFPFAWRSAVKRTLH 224 >At1g16610.2 68414.m01990 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 407 Score = 27.9 bits (59), Expect = 6.7 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 2/59 (3%) Frame = -1 Query: 411 GSTPYGSVDRSSPPS--LPSNKCGSRNKSTTSLAPPLYTGSASKRTARRCLQQPGPAAQ 241 GS+P S+ RS S L S+ SR+ S+ S +PP G + ARR P P ++ Sbjct: 27 GSSPSRSISRSRSRSRSLSSSSSPSRSVSSGSRSPP-RRGKSPAGPARRGRSPPPPPSK 84 >At1g16610.1 68414.m01989 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 414 Score = 27.9 bits (59), Expect = 6.7 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 2/59 (3%) Frame = -1 Query: 411 GSTPYGSVDRSSPPS--LPSNKCGSRNKSTTSLAPPLYTGSASKRTARRCLQQPGPAAQ 241 GS+P S+ RS S L S+ SR+ S+ S +PP G + ARR P P ++ Sbjct: 27 GSSPSRSISRSRSRSRSLSSSSSPSRSVSSGSRSPP-RRGKSPAGPARRGRSPPPPPSK 84 >At2g42760.1 68415.m05295 expressed protein Length = 267 Score = 27.5 bits (58), Expect = 8.9 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = -2 Query: 470 GNHSSRPIDNED*DHCSSREEVLRMDRWIDPRLPL-YLPTNVDLETRVRRVW 318 GN ++RP +E DHC R+ ++ I R+P + VDL+ + R+W Sbjct: 207 GNRAARPYLSEAWDHCGGRKGKKQITPEIKWRVPAPAAASEVDLKDNL-RLW 257 >At2g27610.1 68415.m03349 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 868 Score = 27.5 bits (58), Expect = 8.9 Identities = 21/67 (31%), Positives = 27/67 (40%) Frame = -3 Query: 520 IVRWTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS 341 +V WT M G KE S MK K + P E YSV + + S S + Sbjct: 362 VVSWTAMISGFLQNDGKEEAVDLFSEMKRKGVRPNEFTYSVILTALPVISPSEVHAQ-VV 420 Query: 340 KQEYDES 320 K Y+ S Sbjct: 421 KTNYERS 427 >At2g11090.1 68415.m01187 expressed protein Length = 151 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 596 ASTRPHITPS*SATWTSVRTCTPTPYCPV 510 +++R H TP S TWT+ R+ TP+ + Sbjct: 30 STSRHHSTPWSSTTWTTTRSHYSTPWSSI 58 >At1g03560.1 68414.m00337 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 660 Score = 27.5 bits (58), Expect = 8.9 Identities = 16/55 (29%), Positives = 26/55 (47%) Frame = +3 Query: 357 WKVEREARIDPPIHTEYFLSGGAMILIFIVDGARAVISFCIRSAIPGYMVVHRTI 521 W+ +E I+P ++T FL G + +F VD A V I +V + T+ Sbjct: 210 WRKMKENGIEPTLYTYNFLMNGLVSAMF-VDSAERVFEVMESGRIKPDIVTYNTM 263 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,206,081 Number of Sequences: 28952 Number of extensions: 372058 Number of successful extensions: 1111 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 1042 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1098 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1467502800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -