BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0113 (725 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 24 1.1 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 24 1.1 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 24 1.1 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 24 1.1 EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-deca... 23 3.3 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 22 4.4 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 4.4 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 22 5.8 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 21 7.7 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 24.2 bits (50), Expect = 1.1 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -3 Query: 714 NWGTRGPPLKKVFTELSRRVKVITIGKRK 628 +WGTR +KK EL K KRK Sbjct: 1058 SWGTREVAVKKTKKELEEEKKQAEEAKRK 1086 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 24.2 bits (50), Expect = 1.1 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -3 Query: 714 NWGTRGPPLKKVFTELSRRVKVITIGKRK 628 +WGTR +KK EL K KRK Sbjct: 1058 SWGTREVAVKKTKKELEEEKKQAEEAKRK 1086 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 24.2 bits (50), Expect = 1.1 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -3 Query: 714 NWGTRGPPLKKVFTELSRRVKVITIGKRK 628 +WGTR +KK EL K KRK Sbjct: 1058 SWGTREVAVKKTKKELEEEKKQAEEAKRK 1086 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 24.2 bits (50), Expect = 1.1 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -3 Query: 714 NWGTRGPPLKKVFTELSRRVKVITIGKRK 628 +WGTR +KK EL K KRK Sbjct: 1058 SWGTREVAVKKTKKELEEEKKQAEEAKRK 1086 >EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-decarboxylase protein. Length = 540 Score = 22.6 bits (46), Expect = 3.3 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 358 STDPYGVLPLWRSNDLN 408 + DPYG++ W ++ LN Sbjct: 141 AVDPYGLVAQWATDALN 157 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 22.2 bits (45), Expect = 4.4 Identities = 13/41 (31%), Positives = 16/41 (39%) Frame = -3 Query: 327 QMWISKQEYDESGPSIVHRKCF*TPARRCLQQPAAGCSIQA 205 Q + QEY PS +H P Q A C +QA Sbjct: 100 QQQMDGQEYRPDSPSSMHMANTAAPNGHQTQVVYASCKLQA 140 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -1 Query: 338 LPSNRCGSRNRSTTSLAPPLYTG 270 LP++RC SR S + + P +G Sbjct: 79 LPNSRCNSRESSDSLVQPRCPSG 101 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 21.8 bits (44), Expect = 5.8 Identities = 18/54 (33%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Frame = -3 Query: 714 NWGTRGPP-LKKVFTELSRRVKVITIGKRKDSGCPEALFPTLVLGYGSLRHPRD 556 N T G P + KV ELS K + G + S E L LV HP + Sbjct: 281 NSTTNGSPDVIKVEPELSDSEKTLCNGSKGISPEQEELIHRLVYFQNEYEHPSE 334 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 21.4 bits (43), Expect = 7.7 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = -2 Query: 634 TKRFRLPRGSLSNPRSWVWK 575 T R PR S+P W W+ Sbjct: 40 TYRQPYPRQKKSHPPQWTWQ 59 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,627 Number of Sequences: 336 Number of extensions: 4076 Number of successful extensions: 14 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19363530 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -