BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0111 (726 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 23 1.9 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 2.5 AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain tran... 23 3.3 AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia or... 23 3.3 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = +1 Query: 304 TSTLRSSTMLSQELEPTKKPSSRSCARFPTMVSVP 408 ++T+ +S+ + PT +S SC P+M P Sbjct: 10 STTMATSSNAMSPMTPTYSMNSMSCVSMPSMNCSP 44 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.0 bits (47), Expect = 2.5 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = +3 Query: 351 DEEAIIEILCTLSNYGIRTISAFYEQLYGKSLESDLKGDTSGH 479 D ++ +++C +N+ A+Y Q GK L SD+ D H Sbjct: 1818 DPKSEFKVVCYFTNW------AWYRQGVGKYLPSDIDPDLCTH 1854 >AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain transcription factor Maxillopediaprotein. Length = 523 Score = 22.6 bits (46), Expect = 3.3 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 603 PTNQSSTSILITRFLSAAENRSSPEY 680 PT ++S S FLS N +PEY Sbjct: 495 PTGENSNSSSDFNFLSNLANDYTPEY 520 >AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia ortholog protein. Length = 471 Score = 22.6 bits (46), Expect = 3.3 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 603 PTNQSSTSILITRFLSAAENRSSPEY 680 PT ++S S FLS N +PEY Sbjct: 443 PTGENSNSSSDFNFLSNLANDYTPEY 468 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,919 Number of Sequences: 336 Number of extensions: 3350 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19363530 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -