BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0110 (568 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF080546-1|AAC29475.1| 432|Anopheles gambiae S-adenosyl-L-homoc... 165 1e-42 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 25 2.3 >AF080546-1|AAC29475.1| 432|Anopheles gambiae S-adenosyl-L-homocysteine hydrolase protein. Length = 432 Score = 165 bits (400), Expect = 1e-42 Identities = 75/104 (72%), Positives = 87/104 (83%) Frame = +1 Query: 253 QIAGSLHMTVQTAVLIETLIELGAEVQWSSSNIYSTQDEAAAALVAVGIPIYAWKGETDD 432 +IAG LHMT+QTAVLIETLIELGAEVQWSS NI+STQD AAAA+V G+P+YAWKGETD+ Sbjct: 48 RIAGCLHMTIQTAVLIETLIELGAEVQWSSCNIFSTQDHAAAAMVKAGVPVYAWKGETDE 107 Query: 433 EYIWCIEQTLIFPDGKPLNMILDDGVT*QT*STLSTPDLLKDVK 564 EY+WCI QTLIFPDGKPLNMILDDG P+LLK+++ Sbjct: 108 EYMWCIRQTLIFPDGKPLNMILDDGGDLTNLVHAEHPELLKEIR 151 Score = 77.4 bits (182), Expect = 3e-16 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = +2 Query: 119 KPPYKIADEKLAEWGRKEIMLAEKEMPGLMACRRKYAPAKILKGAK 256 KP YK+AD LAE+GRKEI+LAE EMPGLMACR+KY P KIL+GA+ Sbjct: 3 KPAYKVADISLAEFGRKEIVLAENEMPGLMACRQKYGPLKILRGAR 48 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 24.6 bits (51), Expect = 2.3 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 231 GAYFRRHAIRPGISFSANI 175 G Y RR+A+RP I ANI Sbjct: 1812 GKYKRRYAMRPEIKVLANI 1830 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 608,232 Number of Sequences: 2352 Number of extensions: 12662 Number of successful extensions: 27 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 53404389 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -