Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0108
         (673 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U09586-1|AAC47270.1|  425|Tribolium castaneum ORF 1 protein.           22   5.3  
EF592537-1|ABQ95983.1|  593|Tribolium castaneum beta-N-acetylglu...    22   5.3  

>U09586-1|AAC47270.1|  425|Tribolium castaneum ORF 1 protein.
          Length = 425

 Score = 21.8 bits (44), Expect = 5.3
 Identities = 10/45 (22%), Positives = 18/45 (40%)
 Frame = -3

Query: 278 GYTNYIQ*ITSNFWSKNGSRSVEVEVLRKRQKTKRIRLKSIFILY 144
           GY ++ +     +WS    R +  ++   R    R  + S F  Y
Sbjct: 205 GYEDFRRDFLRTYWSAKRQRDIRFQIATGRYDETRGTMLSHFAYY 249


>EF592537-1|ABQ95983.1|  593|Tribolium castaneum
           beta-N-acetylglucosaminidase NAG2 protein.
          Length = 593

 Score = 21.8 bits (44), Expect = 5.3
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = +3

Query: 270 CISNQGQCW 296
           C  N+G+CW
Sbjct: 585 CYQNEGECW 593


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 152,444
Number of Sequences: 336
Number of extensions: 3108
Number of successful extensions: 3
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 17489640
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)