BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0108 (673 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 22 5.3 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 22 5.3 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 21.8 bits (44), Expect = 5.3 Identities = 10/45 (22%), Positives = 18/45 (40%) Frame = -3 Query: 278 GYTNYIQ*ITSNFWSKNGSRSVEVEVLRKRQKTKRIRLKSIFILY 144 GY ++ + +WS R + ++ R R + S F Y Sbjct: 205 GYEDFRRDFLRTYWSAKRQRDIRFQIATGRYDETRGTMLSHFAYY 249 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 21.8 bits (44), Expect = 5.3 Identities = 5/9 (55%), Positives = 7/9 (77%) Frame = +3 Query: 270 CISNQGQCW 296 C N+G+CW Sbjct: 585 CYQNEGECW 593 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,444 Number of Sequences: 336 Number of extensions: 3108 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17489640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -