BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0108 (673 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL021466-1|CAA16282.1| 308|Caenorhabditis elegans Hypothetical ... 31 0.99 AF016679-1|AAB66162.1| 539|Caenorhabditis elegans Hypothetical ... 29 2.3 U58754-8|AAK72082.1| 325|Caenorhabditis elegans Serpentine rece... 28 6.9 >AL021466-1|CAA16282.1| 308|Caenorhabditis elegans Hypothetical protein VF36H2L.1 protein. Length = 308 Score = 30.7 bits (66), Expect = 0.99 Identities = 20/58 (34%), Positives = 26/58 (44%) Frame = -2 Query: 645 TRILYIRLLDIVIRKLGSFNGRQAGLGSAPGSADVHGRR*QLTIRCPYAHLSISASAY 472 +R+ Y LL R L RQ + APG +D+H R L + C ISA Y Sbjct: 78 SRVAYFMLLKKAQRGLNKIT-RQGQISVAPGVSDLHNARHMLALVCGLGMGVISALFY 134 >AF016679-1|AAB66162.1| 539|Caenorhabditis elegans Hypothetical protein T28C12.5 protein. Length = 539 Score = 29.5 bits (63), Expect = 2.3 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = +2 Query: 536 PWTSALPGAEPKPACLPLKLPNLRITISNNLIYKILVSQMVVTHT 670 PW ALP A CL L + +I N I K+LVS+ ++ T Sbjct: 84 PWDKALPSANQSEDCLYLNVFAPKIREDKN-ICKLLVSREIIVVT 127 >U58754-8|AAK72082.1| 325|Caenorhabditis elegans Serpentine receptor, class d (delta)protein 13 protein. Length = 325 Score = 27.9 bits (59), Expect = 6.9 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = -3 Query: 296 PTLSLVGYTNYIQ*ITSNFWSKNGSRSVEVEVLRKRQKTKRIRLKSIFILY 144 PT VGY+ + + + WS S S +L K T+ + + IF++Y Sbjct: 86 PTTCYVGYSLMLHCFSHSLWSLLLSFSYRCYILYKPAPTRPVLVLIIFLIY 136 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,319,277 Number of Sequences: 27780 Number of extensions: 280898 Number of successful extensions: 456 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 443 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 456 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1518563232 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -