BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0108 (673 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g47885.1 68414.m05331 leucine-rich repeat family protein cont... 30 1.2 At1g32980.1 68414.m04062 subtilisin-like serine protease-related... 28 6.5 >At1g47885.1 68414.m05331 leucine-rich repeat family protein contains 2 leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611 Length = 107 Score = 30.3 bits (65), Expect = 1.2 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +2 Query: 554 PGAEPKPACLPLKLPNLRITISNNLIYKI 640 PGA+PKPA L L N+ + +NN +I Sbjct: 17 PGAKPKPAATQLSLSNIFLGFNNNFTGEI 45 >At1g32980.1 68414.m04062 subtilisin-like serine protease-related similar to subtilase SP1 [Oryza sativa] GI:9957714 Length = 276 Score = 27.9 bits (59), Expect = 6.5 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +2 Query: 560 AEPKPACLPLKLPNLRITISNNLIYKILVSQMVVTHTP 673 A PKP+ L LKLP++ I NL ++++++ V P Sbjct: 199 ANPKPSVLDLKLPSITIP---NLAKEVIITRTVTNVGP 233 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,418,104 Number of Sequences: 28952 Number of extensions: 259596 Number of successful extensions: 530 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 524 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 530 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1422784080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -