BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0105 (550 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 25 1.2 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 24 3.8 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 6.6 AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. 23 6.6 DQ139945-1|ABA29466.1| 399|Anopheles gambiae protein O-fucosylt... 23 8.8 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 25.4 bits (53), Expect = 1.2 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = +2 Query: 278 KSTVSGSGGSEMTCFGRPSTAFHSVRRIGNVVTGGHI*EGSR 403 ++ +S S T PS AF+ RRI + G + EGSR Sbjct: 121 QAALSESDPESATSKAHPS-AFYDARRINEYQSDGRLAEGSR 161 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 23.8 bits (49), Expect = 3.8 Identities = 12/39 (30%), Positives = 17/39 (43%) Frame = +2 Query: 272 VPKSTVSGSGGSEMTCFGRPSTAFHSVRRIGNVVTGGHI 388 + S++ G GGS + G HSV V GG + Sbjct: 671 IGSSSLGGGGGSGRSSSGGGMIGMHSVAAGAAVAAGGGV 709 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.0 bits (47), Expect = 6.6 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +1 Query: 172 SGEKLSGLCLRVNLLVEPFVASDGFDEKV 258 SG+ L CL LV+ +DG D+ V Sbjct: 357 SGQSLVSFCLASKTLVKEANKNDGNDQSV 385 >AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. Length = 1229 Score = 23.0 bits (47), Expect = 6.6 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -2 Query: 114 ARVRVSNIVRFEPREL 67 AR+ V+NI +FE REL Sbjct: 794 ARIGVANIRQFEEREL 809 >DQ139945-1|ABA29466.1| 399|Anopheles gambiae protein O-fucosyltransferase 1 protein. Length = 399 Score = 22.6 bits (46), Expect = 8.8 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = -2 Query: 405 TREPSHMWPPVTTFPILRTEWKAVDGRPKH 316 T PS +WPP TE +DG H Sbjct: 100 TLAPS-LWPPAERISFCYTERMGLDGSTGH 128 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 530,124 Number of Sequences: 2352 Number of extensions: 10619 Number of successful extensions: 16 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50881347 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -