BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0104 (574 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 22 4.3 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 22 4.3 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 21 7.5 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 9.9 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 9.9 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 21.8 bits (44), Expect = 4.3 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 82 GHLNNATSVKFQPNPPV 132 G++ N T K++PNP + Sbjct: 141 GNVLNLTMPKYEPNPSI 157 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 21.8 bits (44), Expect = 4.3 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 82 GHLNNATSVKFQPNPPV 132 G++ N T K++PNP + Sbjct: 141 GNVLNLTMPKYEPNPSI 157 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 21.0 bits (42), Expect = 7.5 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = -2 Query: 231 YYLCKNRVVKLKQVILYRMRREFWSEGRQTPE 136 YY+C + VI+ + E W+ R+ E Sbjct: 135 YYVCLAMTITGPLVIIGNIAMELWNMPRENIE 166 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 20.6 bits (41), Expect = 9.9 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = +3 Query: 357 PKHPVSHYPLQLYNAIHTRIVTMTIVSQINSDT 455 P++PV P + N + +T V +SDT Sbjct: 746 PRNPVGTNPHDINNPLSVNQLTGQCVRNDSSDT 778 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 20.6 bits (41), Expect = 9.9 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = +3 Query: 357 PKHPVSHYPLQLYNAIHTRIVTMTIVSQINSDT 455 P++PV P + N + +T V +SDT Sbjct: 638 PRNPVGTNPHDINNPLSVNQLTGQCVRNDSSDT 670 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,548 Number of Sequences: 336 Number of extensions: 2335 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14203976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -