BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0104 (574 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_1155 + 26541137-26541142,26541244-26542623,26542730-265428... 29 3.5 01_05_0475 - 22571571-22572466,22572626-22572947 28 4.6 >12_02_1155 + 26541137-26541142,26541244-26542623,26542730-26542852, 26542996-26543168,26543332-26543572,26543931-26544023, 26544092-26544232,26544358-26544450,26544633-26544837, 26544993-26545078,26545532-26545620,26545736-26545820, 26545898-26545954,26546319-26546399,26547130-26547321 Length = 1014 Score = 28.7 bits (61), Expect = 3.5 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -2 Query: 132 HRWIRLEFNRGRVIQMSTGRCSDGAPGSL 46 H+ + L+F+ GRVI TG S G+ G + Sbjct: 245 HKQLTLDFSAGRVISSDTGGDSPGSGGKI 273 >01_05_0475 - 22571571-22572466,22572626-22572947 Length = 405 Score = 28.3 bits (60), Expect = 4.6 Identities = 17/38 (44%), Positives = 25/38 (65%) Frame = -2 Query: 435 RR*SSSLSVYESRCKVVMDSAIQGVSGRRAGSVTSQRL 322 RR SSLS+ + KV++ S++QGVS R G+ + RL Sbjct: 186 RRFQSSLSMIKFVSKVILISSVQGVS--RLGTTQALRL 221 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,478,869 Number of Sequences: 37544 Number of extensions: 255977 Number of successful extensions: 646 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 637 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 646 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1328870592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -