BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0104 (574 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC084197-18|AAM44394.1| 546|Caenorhabditis elegans Hypothetical... 28 4.1 Z79696-1|CAB01972.1| 1584|Caenorhabditis elegans Hypothetical pr... 27 9.5 >AC084197-18|AAM44394.1| 546|Caenorhabditis elegans Hypothetical protein Y73B6BL.4 protein. Length = 546 Score = 28.3 bits (60), Expect = 4.1 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = -3 Query: 572 PPPGDRTVAKSALQRAGAVTSRGYIQRVF--FVSLTDNKLHSVGI 444 PP T++ A TS GYI +F FVS +N L+ + + Sbjct: 45 PPGSSATISAPGASAATVPTSYGYISNMFKNFVSKVENPLNYLSV 89 >Z79696-1|CAB01972.1| 1584|Caenorhabditis elegans Hypothetical protein F54F3.1 protein. Length = 1584 Score = 27.1 bits (57), Expect = 9.5 Identities = 16/41 (39%), Positives = 24/41 (58%) Frame = -3 Query: 563 GDRTVAKSALQRAGAVTSRGYIQRVFFVSLTDNKLHSVGIY 441 G RTV S+LQ +T Q+ ++ DN++HSVG+Y Sbjct: 1481 GRRTVF-SSLQYPFGLT-HDEEQKFYWTDWKDNRIHSVGVY 1519 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,403,670 Number of Sequences: 27780 Number of extensions: 231911 Number of successful extensions: 511 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 499 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 511 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1184216096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -