BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0103 (646 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34715| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_56071| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 >SB_34715| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 977 Score = 29.5 bits (63), Expect = 2.4 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = -2 Query: 225 YSRHLPFEASIRIYTKTKKKFKS 157 Y +P+ S+RI++K KKK+KS Sbjct: 322 YLHEMPYYCSLRIFSKEKKKWKS 344 >SB_56071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 856 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +3 Query: 342 LELVKSSWPKR*EVQCIRICSDAPVFESRGRVPIFLMKY 458 LE VK+S R +Q +R+ AP + G+VPIF ++ Sbjct: 386 LEEVKTS-RSRWTIQALRLLVPAPEVNNMGKVPIFRKEF 423 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,496,575 Number of Sequences: 59808 Number of extensions: 456056 Number of successful extensions: 901 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 824 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 900 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1633044375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -