BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0103 (646 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 24 1.4 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 23 3.3 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 23.8 bits (49), Expect = 1.4 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = -2 Query: 237 NRTHYSRHL--PFEASIRIYTKTKKKFKSLYMY 145 N H+ HL PFE IRI K ++ YM+ Sbjct: 206 NLHHWHWHLVYPFEGDIRIVNKDRRGELFYYMH 238 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 22.6 bits (46), Expect = 3.3 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -1 Query: 322 QRRQYPLHQYVRGSLPAVSHASHA 251 +R+QY LHQ+ G P +++ S A Sbjct: 178 ERKQYYLHQFATGQ-PDLNYRSAA 200 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 187,860 Number of Sequences: 438 Number of extensions: 4271 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19438227 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -