BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0101 (539 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1575 - 27848977-27849095,27849254-27849302,27850270-278502... 29 1.8 01_06_0364 - 28749825-28750053,28750442-28750621,28751018-287511... 27 7.2 >07_03_1575 - 27848977-27849095,27849254-27849302,27850270-27850287, 27850798-27851786,27852119-27852733,27852893-27852921, 27853990-27854453,27854530-27854654,27854743-27855025, 27855112-27856102,27856965-27857576,27857666-27858630 Length = 1752 Score = 29.5 bits (63), Expect = 1.8 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = +1 Query: 394 NTRHRSTVTILYKPIIHIINVNCTLVTRYWRRGARLN 504 ++RH ST KP I + V+ V YWRRG RL+ Sbjct: 894 SSRHGSTRKPGRKPFIVELKVDSRDVGVYWRRGGRLS 930 >01_06_0364 - 28749825-28750053,28750442-28750621,28751018-28751147, 28751442-28751756,28752033-28752075,28752108-28752500 Length = 429 Score = 27.5 bits (58), Expect = 7.2 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +3 Query: 375 TLKRYLEHATSLNSDNTLQTHNTYH 449 TL+RY E SL SD HN YH Sbjct: 307 TLERYKEREKSLISDFKKLCHNNYH 331 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,240,153 Number of Sequences: 37544 Number of extensions: 156567 Number of successful extensions: 184 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 184 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 184 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1198356516 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -