BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0096 (503 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 2e-19 SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 4e-18 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 4e-18 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 6e-18 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 87 6e-18 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 85 2e-17 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 85 2e-17 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 84 7e-17 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 84 7e-17 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 84 7e-17 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 83 1e-16 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 2e-16 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 5e-16 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 2e-15 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 3e-14 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 3e-14 SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 6e-14 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 6e-14 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 6e-14 SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 3e-13 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 3e-13 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 4e-13 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 5e-13 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 4e-12 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 9e-12 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 64 6e-11 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 64 6e-11 SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_26800| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_52731| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 2e-10 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 2e-10 SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 2e-10 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 8e-10 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 8e-10 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 3e-09 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 58 4e-09 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 58 4e-09 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 58 4e-09 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 58 4e-09 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 58 4e-09 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 58 4e-09 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 58 4e-09 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 58 4e-09 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 58 4e-09 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 58 4e-09 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 58 4e-09 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 58 4e-09 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 58 4e-09 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 58 4e-09 SB_15919| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 7e-09 SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_25288| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 1e-08 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 1e-08 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 3e-08 SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) 55 3e-08 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 3e-08 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 3e-08 SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) 55 4e-08 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 54 5e-08 SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) 54 5e-08 SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 54 5e-08 SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 54 5e-08 SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 54 5e-08 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 54 5e-08 SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_48895| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) 54 5e-08 SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) 54 5e-08 SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) 54 5e-08 SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 54 5e-08 SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) 54 5e-08 SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) 54 5e-08 SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) 54 5e-08 SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 54 5e-08 SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) 54 5e-08 SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 54 5e-08 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 54 5e-08 SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) 54 5e-08 SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) 54 5e-08 SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) 54 5e-08 SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_24322| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) 54 5e-08 SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 54 5e-08 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 54 5e-08 SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 54 5e-08 SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) 54 5e-08 SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 54 5e-08 SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) 54 5e-08 SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) 54 5e-08 SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) 54 5e-08 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 54 5e-08 SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 54 5e-08 SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 54 5e-08 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) 54 5e-08 SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 54 5e-08 SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 54 5e-08 SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) 54 5e-08 SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 54 5e-08 SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 54 5e-08 SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) 54 5e-08 SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) 54 5e-08 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 54 5e-08 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) 54 5e-08 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 54 5e-08 SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 54 5e-08 SB_42847| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 54 5e-08 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 54 5e-08 SB_40884| Best HMM Match : Homeobox (HMM E-Value=0.068) 54 5e-08 SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 54 5e-08 SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_38282| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_38080| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_37703| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_37072| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_36830| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 54 5e-08 SB_36604| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_36374| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_35614| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_35131| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_34873| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_34844| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 54 5e-08 SB_34216| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 54 5e-08 SB_33422| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_33231| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_32024| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_31980| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_31481| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_31350| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_30835| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 54 5e-08 SB_30479| Best HMM Match : WD40 (HMM E-Value=1.1e-06) 54 5e-08 SB_30218| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_29409| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_29177| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_29145| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_28808| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_28480| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_26038| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_25820| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_25742| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_25630| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_24684| Best HMM Match : Phage_rep_O (HMM E-Value=2.3) 54 5e-08 SB_24127| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 54 5e-08 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 54 5e-08 SB_23282| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_22993| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 54 5e-08 SB_21177| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 54 5e-08 SB_20277| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_20097| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_19885| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 54 5e-08 SB_18235| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_17265| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_16846| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_16672| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_16494| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_16270| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_16198| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_15539| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_14857| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_14581| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_14087| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_13215| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_12828| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_12518| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) 54 5e-08 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_11228| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_11209| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_11018| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_10523| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_10150| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_9428| Best HMM Match : Vicilin_N (HMM E-Value=4.2) 54 5e-08 SB_9090| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_8817| Best HMM Match : I-set (HMM E-Value=0) 54 5e-08 SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_7590| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_7267| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_6665| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_6263| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) 54 5e-08 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 54 5e-08 SB_4702| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_4674| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 54 5e-08 SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_4402| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_4342| Best HMM Match : KA1 (HMM E-Value=0.53) 54 5e-08 SB_2432| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_2348| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_2263| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_1977| Best HMM Match : Filament_head (HMM E-Value=4.2) 54 5e-08 SB_1945| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_1808| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_1435| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_1403| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_1099| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_938| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_758| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_357| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_50382| Best HMM Match : RVT_1 (HMM E-Value=0.026) 54 7e-08 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 54 7e-08 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 54 9e-08 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 53 1e-07 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_6302| Best HMM Match : DUF594 (HMM E-Value=4.4) 53 1e-07 SB_39508| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 53 1e-07 SB_24882| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_13915| Best HMM Match : CAT (HMM E-Value=7.9e-08) 53 1e-07 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 53 2e-07 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 53 2e-07 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 53 2e-07 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 53 2e-07 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 53 2e-07 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 53 2e-07 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 53 2e-07 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 53 2e-07 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 53 2e-07 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 53 2e-07 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 53 2e-07 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 53 2e-07 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 53 2e-07 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 53 2e-07 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 92.7 bits (220), Expect = 2e-19 Identities = 44/55 (80%), Positives = 48/55 (87%), Gaps = 2/55 (3%) Frame = -1 Query: 419 GRS-GAGLFVITPAGKRGMCLQGD*-VG*RQGFPSHDVVKRRPVNCNTTHYRANW 261 GR+ GAGLF ITPAG++G LQGD +G RQGFPSHDVVKRRPVNCNTTHYRANW Sbjct: 48 GRAIGAGLFAITPAGEKGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHYRANW 102 Score = 32.7 bits (71), Expect = 0.18 Identities = 17/40 (42%), Positives = 23/40 (57%) Frame = -3 Query: 480 YQNINAYNLPFPIQVAQLLERAIGCGPFRYYASWQKGNVL 361 +Q++ P Q AQLL RAIG G F + +KG+VL Sbjct: 29 HQDLFILRSDLPSQAAQLLGRAIGAGLFAITPAGEKGDVL 68 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/47 (87%), Positives = 43/47 (91%) Frame = +3 Query: 279 SRITIHWPSFYNVVTGKTLALPNLIALQAHSPFASWRNNEKARTRSP 419 SRITIHWPSFYNVVTGKTLALPNLIALQ H PFASWRN+E+ART P Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQLHPPFASWRNSEEARTDRP 48 Score = 29.9 bits (64), Expect = 1.2 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = +1 Query: 412 DRPFQQLRNLNGEW 453 DRP Q+LR+LNGEW Sbjct: 46 DRPSQRLRSLNGEW 59 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 92.3 bits (219), Expect = 2e-19 Identities = 41/47 (87%), Positives = 43/47 (91%) Frame = +3 Query: 279 SRITIHWPSFYNVVTGKTLALPNLIALQAHSPFASWRNNEKARTRSP 419 SRITIHWPSFYNVVTGKTLALPNLIAL AH PFASWRN+E+ART P Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALAAHPPFASWRNSEEARTDRP 48 Score = 31.5 bits (68), Expect = 0.41 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 412 DRPFQQLRNLNGEW 453 DRP QQLR+LNGEW Sbjct: 46 DRPSQQLRSLNGEW 59 >SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 89.8 bits (213), Expect = 1e-18 Identities = 40/49 (81%), Positives = 43/49 (87%) Frame = -3 Query: 435 AQLLERAIGCGPFRYYASWQKGNVLARRLSWVTPGFSQSRRCKTTASEL 289 AQLL + CGP RYYASW+KG+VL RRLSWVTPGFSQSRRCKTTASEL Sbjct: 2 AQLLGKGDRCGPLRYYASWRKGDVLQRRLSWVTPGFSQSRRCKTTASEL 50 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 87.8 bits (208), Expect = 4e-18 Identities = 40/47 (85%), Positives = 42/47 (89%) Frame = +3 Query: 279 SRITIHWPSFYNVVTGKTLALPNLIALQAHSPFASWRNNEKARTRSP 419 SRITIHWPSFYNVVTGKTLALPNLIALQ PFASWRN+E+ART P Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPPFASWRNSEEARTDRP 48 Score = 36.7 bits (81), Expect = 0.011 Identities = 18/43 (41%), Positives = 23/43 (53%) Frame = +1 Query: 325 GKPWRYPT*SPCKHIPLLPAGVITKRPAPDRPFQQLRNLNGEW 453 GK P +HIP + ++ DRP QQLR+LNGEW Sbjct: 17 GKTLALPNLIALQHIPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 87.8 bits (208), Expect = 4e-18 Identities = 40/54 (74%), Positives = 44/54 (81%), Gaps = 1/54 (1%) Frame = -1 Query: 419 GRS-GAGLFVITPAGKRGMCLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 261 GR+ GAGLF ITPAG+RGMC + +G FPSHDVVKRRPVNCNTTHYRANW Sbjct: 14 GRAIGAGLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 67 Score = 31.9 bits (69), Expect = 0.31 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = -3 Query: 456 LPFPIQVAQLLERAIGCGPFRYYASWQKG 370 +PF IQ AQLL RAIG G F + ++G Sbjct: 3 VPFAIQAAQLLGRAIGAGLFAITPAGERG 31 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 87.4 bits (207), Expect = 6e-18 Identities = 37/48 (77%), Positives = 41/48 (85%) Frame = -1 Query: 404 GLFVITPAGKRGMCLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 261 GLF ITPAG+RGMC + +G +GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 12 GLFAITPAGERGMCCKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 Score = 48.0 bits (109), Expect = 4e-06 Identities = 23/38 (60%), Positives = 27/38 (71%) Frame = -2 Query: 436 CATVGKGDRVRAFSLLRQLAKGECACKAIKLGNARVFP 323 CATVGKGDR F++ +G C CKAIKLGNA+ FP Sbjct: 2 CATVGKGDRCGLFAITPAGERGMC-CKAIKLGNAKGFP 38 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 87.4 bits (207), Expect = 6e-18 Identities = 38/50 (76%), Positives = 41/50 (82%) Frame = -1 Query: 410 GAGLFVITPAGKRGMCLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 261 GAGLF ITPAG+RGMC + +G FPSHDVVKRRPVNCNTTHYRANW Sbjct: 4 GAGLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 53 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 85.4 bits (202), Expect = 2e-17 Identities = 39/54 (72%), Positives = 43/54 (79%), Gaps = 1/54 (1%) Frame = -1 Query: 419 GRS-GAGLFVITPAGKRGMCLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 261 GR+ GAGLF ITPAG+RGMC + + FPSHDVVKRRPVNCNTTHYRANW Sbjct: 8 GRAIGAGLFAITPAGERGMCCKSIKLAHASVFPSHDVVKRRPVNCNTTHYRANW 61 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 85.4 bits (202), Expect = 2e-17 Identities = 40/65 (61%), Positives = 45/65 (69%) Frame = +3 Query: 225 CIAVTPSRGGRYPIRPIVSRITIHWPSFYNVVTGKTLALPNLIALQAHSPFASWRNNEKA 404 C + GG PIRPIVSRITIHWP+FYN TGKTLA L L AH PFASWRN+++A Sbjct: 28 CSRAAATDGGA-PIRPIVSRITIHWPAFYNAPTGKTLAYTQLNRLAAHPPFASWRNSQEA 86 Query: 405 RTRSP 419 R P Sbjct: 87 RADRP 91 Score = 31.5 bits (68), Expect = 0.41 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 412 DRPFQQLRNLNGEW 453 DRP QQLR+LNGEW Sbjct: 89 DRPSQQLRSLNGEW 102 >SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 85.0 bits (201), Expect = 3e-17 Identities = 37/50 (74%), Positives = 41/50 (82%) Frame = -3 Query: 438 VAQLLERAIGCGPFRYYASWQKGNVLARRLSWVTPGFSQSRRCKTTASEL 289 V Q+ ++ CGP RYYASW+KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 61 VKQVTQQGDRCGPLRYYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 110 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 83.8 bits (198), Expect = 7e-17 Identities = 39/64 (60%), Positives = 43/64 (67%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRGMCLQGD*VG*RQGFPSHDVVKRRPVNCNTTHY 273 HSPFRLRNCW+GRS ++ K G + GFPSHDVVKRRPVNCNTTHY Sbjct: 589 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRL----SWGFPSHDVVKRRPVNCNTTHY 644 Query: 272 RANW 261 RANW Sbjct: 645 RANW 648 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 83.8 bits (198), Expect = 7e-17 Identities = 39/64 (60%), Positives = 43/64 (67%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRGMCLQGD*VG*RQGFPSHDVVKRRPVNCNTTHY 273 HSPFRLRNCW+GRS ++ K G + GFPSHDVVKRRPVNCNTTHY Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRL----SWGFPSHDVVKRRPVNCNTTHY 87 Query: 272 RANW 261 RANW Sbjct: 88 RANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 83.8 bits (198), Expect = 7e-17 Identities = 39/64 (60%), Positives = 43/64 (67%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRGMCLQGD*VG*RQGFPSHDVVKRRPVNCNTTHY 273 HSPFRLRNCW+GRS ++ K G + GFPSHDVVKRRPVNCNTTHY Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRL----SWGFPSHDVVKRRPVNCNTTHY 87 Query: 272 RANW 261 RANW Sbjct: 88 RANW 91 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 83.4 bits (197), Expect = 1e-16 Identities = 39/53 (73%), Positives = 43/53 (81%), Gaps = 1/53 (1%) Frame = -1 Query: 419 GRS-GAGLFVITPAGKRGMCLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRAN 264 GRS GAGLF ITPAG+RGMC + +G +GFPSHD KRRPVNCNTTHYRAN Sbjct: 45 GRSIGAGLFAITPAGERGMCCKAIKLGNARGFPSHDGEKRRPVNCNTTHYRAN 97 >SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 82.2 bits (194), Expect = 2e-16 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -3 Query: 408 CGPFRYYASWQKGNVLARRLSWVTPGFSQSRRCKTTASEL 289 CGP RYYASW+KG+VL RLSWVTPGFSQSRRCKTTASEL Sbjct: 11 CGPLRYYASWRKGDVLQGRLSWVTPGFSQSRRCKTTASEL 50 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 81.0 bits (191), Expect = 5e-16 Identities = 39/54 (72%), Positives = 43/54 (79%), Gaps = 1/54 (1%) Frame = -1 Query: 419 GRS-GAGLFVITPAGKRGMCLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 261 GR+ GAGLF ITPAG+RGMC + + FPSHDVVKRRPVNCNTTHYRANW Sbjct: 1847 GRAIGAGLFAITPAGERGMCCKAIKLV-TPVFPSHDVVKRRPVNCNTTHYRANW 1899 Score = 35.5 bits (78), Expect = 0.025 Identities = 19/43 (44%), Positives = 26/43 (60%) Frame = -3 Query: 456 LPFPIQVAQLLERAIGCGPFRYYASWQKGNVLARRLSWVTPGF 328 +PF IQ AQLL RAIG G F + ++G + + + VTP F Sbjct: 1836 VPFAIQAAQLLGRAIGAGLFAITPAGERG-MCCKAIKLVTPVF 1877 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 79.4 bits (187), Expect = 2e-15 Identities = 35/47 (74%), Positives = 39/47 (82%) Frame = +3 Query: 279 SRITIHWPSFYNVVTGKTLALPNLIALQAHSPFASWRNNEKARTRSP 419 SRITIHWPSFYNVVTGKTL++ L L AH PFASWRN+E+ART P Sbjct: 2 SRITIHWPSFYNVVTGKTLSVTQLNRLAAHPPFASWRNSEEARTDRP 48 Score = 31.5 bits (68), Expect = 0.41 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 412 DRPFQQLRNLNGEW 453 DRP QQLR+LNGEW Sbjct: 46 DRPSQQLRSLNGEW 59 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 74.9 bits (176), Expect = 3e-14 Identities = 33/47 (70%), Positives = 36/47 (76%) Frame = +3 Query: 279 SRITIHWPSFYNVVTGKTLALPNLIALQAHSPFASWRNNEKARTRSP 419 SRITIHWPSFYNVVTGK + L L AH PFASWRN+E+ART P Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFASWRNSEEARTDRP 48 Score = 31.5 bits (68), Expect = 0.41 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 412 DRPFQQLRNLNGEW 453 DRP QQLR+LNGEW Sbjct: 46 DRPSQQLRSLNGEW 59 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 74.9 bits (176), Expect = 3e-14 Identities = 33/47 (70%), Positives = 36/47 (76%) Frame = +3 Query: 279 SRITIHWPSFYNVVTGKTLALPNLIALQAHSPFASWRNNEKARTRSP 419 SRITIHWPSFYNVVTGK + L L AH PFASWRN+E+ART P Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFASWRNSEEARTDRP 48 Score = 31.5 bits (68), Expect = 0.41 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 412 DRPFQQLRNLNGEW 453 DRP QQLR+LNGEW Sbjct: 46 DRPSQQLRSLNGEW 59 >SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 74.1 bits (174), Expect = 6e-14 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = -3 Query: 408 CGPFRYYASWQKGNVLARRLSWVTPGFSQSRRCKTTASEL 289 CGP RYYASW+KG+ A RLS TPGFSQSRRCKTTASEL Sbjct: 40 CGPLRYYASWRKGDATASRLSGATPGFSQSRRCKTTASEL 79 Score = 27.9 bits (59), Expect = 5.0 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -2 Query: 439 GCATVGKGDRVRAFSLLRQLAKGECACKAI 350 GCATVGKGDR KG+ + Sbjct: 30 GCATVGKGDRCGPLRYYASWRKGDATASRL 59 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 74.1 bits (174), Expect = 6e-14 Identities = 33/47 (70%), Positives = 36/47 (76%) Frame = +3 Query: 279 SRITIHWPSFYNVVTGKTLALPNLIALQAHSPFASWRNNEKARTRSP 419 SRITIHWPSFYNVVTGK + L L AH PFASWRN+E+ART P Sbjct: 2 SRITIHWPSFYNVVTGKNPGVTQLNRLAAHPPFASWRNSEEARTDRP 48 Score = 31.5 bits (68), Expect = 0.41 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 412 DRPFQQLRNLNGEW 453 DRP QQLR+LNGEW Sbjct: 46 DRPSQQLRSLNGEW 59 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 74.1 bits (174), Expect = 6e-14 Identities = 35/60 (58%), Positives = 39/60 (65%) Frame = -1 Query: 440 RLRNCWKGRSGAGLFVITPAGKRGMCLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 261 +LRNCW+GRS ++ K G C GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 22 QLRNCWEGRSVRASSLLRQLAKGG-CAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 71.7 bits (168), Expect = 3e-13 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = +3 Query: 294 HWPSFYNVVTGKTLALPNLIALQAHSPFASWRNNEKARTRSP 419 HWPSFYN VTGKTLALPNLIALQ FASWRN+++ART P Sbjct: 5 HWPSFYNDVTGKTLALPNLIALQHIPTFASWRNSQEARTDRP 46 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 71.7 bits (168), Expect = 3e-13 Identities = 32/47 (68%), Positives = 35/47 (74%) Frame = +3 Query: 279 SRITIHWPSFYNVVTGKTLALPNLIALQAHSPFASWRNNEKARTRSP 419 SRITIHWPSFYNV+ KT + L L AH PFASWRN+EKART P Sbjct: 2 SRITIHWPSFYNVMLAKTPGVTQLNRLAAHPPFASWRNSEKARTDRP 48 Score = 31.9 bits (69), Expect = 0.31 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +1 Query: 394 TKRPAPDRPFQQLRNLNGEW 453 +++ DRP QQLR+LNGEW Sbjct: 40 SEKARTDRPSQQLRSLNGEW 59 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 71.3 bits (167), Expect = 4e-13 Identities = 36/51 (70%), Positives = 41/51 (80%), Gaps = 1/51 (1%) Frame = +3 Query: 270 PIVSRITIHWPSFYNVVTGKTLALPNLIALQAHSPFA-SWRNNEKARTRSP 419 P +SRITIHWPSFYNVVTGKTLALPNLIALQ H P + + + E+ART P Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLALPNLIALQ-HIPLSPAGLHREEARTDRP 126 Score = 47.2 bits (107), Expect = 8e-06 Identities = 22/43 (51%), Positives = 26/43 (60%) Frame = +1 Query: 325 GKPWRYPT*SPCKHIPLLPAGVITKRPAPDRPFQQLRNLNGEW 453 GK P +HIPL PAG+ + DRP QQLR+LNGEW Sbjct: 95 GKTLALPNLIALQHIPLSPAGLHREEARTDRPSQQLRSLNGEW 137 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 70.9 bits (166), Expect = 5e-13 Identities = 37/53 (69%), Positives = 42/53 (79%), Gaps = 1/53 (1%) Frame = +3 Query: 264 IRPIVSRITIHWPSFYNVVTGKTLALPNLIALQAHSPFA-SWRNNEKARTRSP 419 +RP+VSRITIHW SFYNVVTGKTLALPNLIALQ H P + + E+ART P Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNLIALQ-HIPLSPAGVIAEEARTDRP 84 Score = 51.6 bits (118), Expect = 4e-07 Identities = 24/43 (55%), Positives = 27/43 (62%) Frame = +1 Query: 325 GKPWRYPT*SPCKHIPLLPAGVITKRPAPDRPFQQLRNLNGEW 453 GK P +HIPL PAGVI + DRP QQLR+LNGEW Sbjct: 53 GKTLALPNLIALQHIPLSPAGVIAEEARTDRPSQQLRSLNGEW 95 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 70.5 bits (165), Expect = 7e-13 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 1/48 (2%) Frame = +3 Query: 279 SRITIHWPSFYNVVTGKTLALPNLIALQAHSPFA-SWRNNEKARTRSP 419 SRITIHWPSFYNVVTGKTLALPNLIALQ H P + + N+E+ART P Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQ-HIPLSPAGVNSEEARTDRP 48 Score = 49.2 bits (112), Expect = 2e-06 Identities = 23/43 (53%), Positives = 27/43 (62%) Frame = +1 Query: 325 GKPWRYPT*SPCKHIPLLPAGVITKRPAPDRPFQQLRNLNGEW 453 GK P +HIPL PAGV ++ DRP QQLR+LNGEW Sbjct: 17 GKTLALPNLIALQHIPLSPAGVNSEEARTDRPSQQLRSLNGEW 59 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = +3 Query: 294 HWPSFYNVVTGKTLALPNLIALQAHSPFASWRNNEKARTRSP 419 HWPSFYNVVTGKTL + L L AH PFASWRN+E+ART P Sbjct: 5 HWPSFYNVVTGKTLGVTQLNRLAAHPPFASWRNSEEARTDRP 46 Score = 33.1 bits (72), Expect = 0.13 Identities = 12/17 (70%), Positives = 16/17 (94%) Frame = +1 Query: 412 DRPFQQLRNLNGEWQIV 462 DRP QQLR+LNGEW+++ Sbjct: 44 DRPSQQLRSLNGEWRLM 60 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 68.1 bits (159), Expect = 4e-12 Identities = 36/64 (56%), Positives = 37/64 (57%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRGMCLQGD*VG*RQGFPSHDVVKRRPVNCNTTHY 273 HSPFRLRNCW+G R GFPSHDVVKRRPVNCNTTHY Sbjct: 43 HSPFRLRNCWEG--------------------------RSGFPSHDVVKRRPVNCNTTHY 76 Query: 272 RANW 261 RANW Sbjct: 77 RANW 80 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 66.9 bits (156), Expect = 9e-12 Identities = 32/47 (68%), Positives = 36/47 (76%) Frame = +3 Query: 279 SRITIHWPSFYNVVTGKTLALPNLIALQAHSPFASWRNNEKARTRSP 419 SRITIHWPSFYNVVTGKTLALPNL L+ +AS +E+ART P Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLFDLRHIPLYASCTTSEEARTDRP 48 Score = 41.1 bits (92), Expect = 5e-04 Identities = 19/43 (44%), Positives = 24/43 (55%) Frame = +1 Query: 325 GKPWRYPT*SPCKHIPLLPAGVITKRPAPDRPFQQLRNLNGEW 453 GK P +HIPL + ++ DRP QQLR+LNGEW Sbjct: 17 GKTLALPNLFDLRHIPLYASCTTSEEARTDRPSQQLRSLNGEW 59 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 66.5 bits (155), Expect = 1e-11 Identities = 30/47 (63%), Positives = 34/47 (72%) Frame = +3 Query: 279 SRITIHWPSFYNVVTGKTLALPNLIALQAHSPFASWRNNEKARTRSP 419 SRITIHWPSFYNVV + + L L AH PFASWRN+E+ART P Sbjct: 2 SRITIHWPSFYNVVHWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 48 Score = 31.5 bits (68), Expect = 0.41 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 412 DRPFQQLRNLNGEW 453 DRP QQLR+LNGEW Sbjct: 46 DRPSQQLRSLNGEW 59 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 66.1 bits (154), Expect = 2e-11 Identities = 31/52 (59%), Positives = 36/52 (69%) Frame = +3 Query: 264 IRPIVSRITIHWPSFYNVVTGKTLALPNLIALQAHSPFASWRNNEKARTRSP 419 IRPIVSRITIHWPSFY + + L L AH PFASWR++E+ART P Sbjct: 18 IRPIVSRITIHWPSFYKRRDWENPGVNQLNRLAAHPPFASWRSSEEARTDRP 69 Score = 31.1 bits (67), Expect = 0.54 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 412 DRPFQQLRNLNGEW 453 DRP QQLR LNGEW Sbjct: 67 DRPSQQLRRLNGEW 80 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 64.9 bits (151), Expect = 4e-11 Identities = 32/43 (74%), Positives = 36/43 (83%), Gaps = 1/43 (2%) Frame = +3 Query: 294 HWPSFYNVVTGKTLALPNLIALQAHSPFA-SWRNNEKARTRSP 419 HWPSFYNVVTGKTLALPNLIALQ H P + + RN+E+ART P Sbjct: 5 HWPSFYNVVTGKTLALPNLIALQ-HIPLSPAGRNSEEARTDRP 46 Score = 48.0 bits (109), Expect = 4e-06 Identities = 22/46 (47%), Positives = 29/46 (63%) Frame = +1 Query: 325 GKPWRYPT*SPCKHIPLLPAGVITKRPAPDRPFQQLRNLNGEWQIV 462 GK P +HIPL PAG ++ DRP QQLR+LNGEW+++ Sbjct: 15 GKTLALPNLIALQHIPLSPAGRNSEEARTDRPSQQLRSLNGEWRLM 60 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 64.1 bits (149), Expect = 6e-11 Identities = 34/56 (60%), Positives = 36/56 (64%) Frame = +3 Query: 252 GRYPIRPIVSRITIHWPSFYNVVTGKTLALPNLIALQAHSPFASWRNNEKARTRSP 419 G PIRPIVS ITIHWPSFYN VT AH PFASWRN+E+ART P Sbjct: 38 GGAPIRPIVSHITIHWPSFYNGVT-------------AHPPFASWRNSEEARTDRP 80 Score = 31.5 bits (68), Expect = 0.41 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 412 DRPFQQLRNLNGEW 453 DRP QQLR+LNGEW Sbjct: 78 DRPSQQLRSLNGEW 91 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 64.1 bits (149), Expect = 6e-11 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +3 Query: 279 SRITIHWPSFYNVVTGKTLALPNLIALQAHSPFA 380 SRITIHWPSFYNVVTGKTLALPNLIALQ H P + Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQ-HIPLS 34 Score = 51.2 bits (117), Expect = 5e-07 Identities = 25/43 (58%), Positives = 28/43 (65%) Frame = +1 Query: 325 GKPWRYPT*SPCKHIPLLPAGVITKRPAPDRPFQQLRNLNGEW 453 GK P +HIPL PAGVI KRPAP +QLR+LNGEW Sbjct: 17 GKTLALPNLIALQHIPLSPAGVIAKRPAPIALPKQLRSLNGEW 59 >SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 62.9 bits (146), Expect = 1e-10 Identities = 34/57 (59%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Frame = -3 Query: 462 YNLPFPIQVAQLLE-RAIGCGPFRYYASWQKGNVLARRLSWVTPGFSQSRRCKTTAS 295 + PF IQ AQLLE R++ + KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 HQAPFAIQAAQLLEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_26800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 62.9 bits (146), Expect = 1e-10 Identities = 30/48 (62%), Positives = 35/48 (72%) Frame = +3 Query: 309 YNVVTGKTLALPNLIALQAHSPFASWRNNEKARTRSPFPTVAQPEWGM 452 Y+VVTGKTLA+P+L ALQ FASWR ++ RSPFP AQPEW M Sbjct: 13 YDVVTGKTLAVPSLNALQHIPHFASWRTYPRSPHRSPFPRDAQPEWRM 60 >SB_52731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 62.5 bits (145), Expect = 2e-10 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRGMC 363 HSPFRLRNCW+GRS GLF ITPAG+RGMC Sbjct: 43 HSPFRLRNCWEGRSVRGLFAITPAGERGMC 72 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 62.5 bits (145), Expect = 2e-10 Identities = 28/49 (57%), Positives = 33/49 (67%) Frame = -1 Query: 407 AGLFVITPAGKRGMCLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 261 A + TP+G + M + + FPSHDVVKRRPVNCNTTHYRANW Sbjct: 11 AVVLATTPSGDKSMYSESNNKSHAIVFPSHDVVKRRPVNCNTTHYRANW 59 >SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 62.5 bits (145), Expect = 2e-10 Identities = 32/48 (66%), Positives = 35/48 (72%), Gaps = 1/48 (2%) Frame = +3 Query: 279 SRITIHWPSFYNVVTGK-TLALPNLIALQAHSPFASWRNNEKARTRSP 419 SRITIHWPSFYNVVTGK T P+L LQ ASWRN+E+ART P Sbjct: 2 SRITIHWPSFYNVVTGKNTGREPSLFDLQYIPLVASWRNSEEARTDRP 49 Score = 36.7 bits (81), Expect = 0.011 Identities = 17/39 (43%), Positives = 25/39 (64%) Frame = +1 Query: 337 RYPT*SPCKHIPLLPAGVITKRPAPDRPFQQLRNLNGEW 453 R P+ ++IPL+ + ++ DRP QQLR+LNGEW Sbjct: 22 REPSLFDLQYIPLVASWRNSEEARTDRPSQQLRSLNGEW 60 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 61.7 bits (143), Expect = 3e-10 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -1 Query: 332 GFPSHDVVKRRPVNCNTTHYRANW 261 GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 1 GFPSHDVVKRRPVNCNTTHYRANW 24 >SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 60.5 bits (140), Expect = 8e-10 Identities = 33/57 (57%), Positives = 37/57 (64%), Gaps = 1/57 (1%) Frame = -3 Query: 462 YNLPFPIQVAQLLE-RAIGCGPFRYYASWQKGNVLARRLSWVTPGFSQSRRCKTTAS 295 + PF IQ AQL E R++ + KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 HQAPFAIQAAQLWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 60.5 bits (140), Expect = 8e-10 Identities = 33/57 (57%), Positives = 37/57 (64%), Gaps = 1/57 (1%) Frame = -3 Query: 462 YNLPFPIQVAQLLE-RAIGCGPFRYYASWQKGNVLARRLSWVTPGFSQSRRCKTTAS 295 + PF IQ AQL E R++ + KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 HQAPFAIQAAQLWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 58.4 bits (135), Expect = 3e-09 Identities = 26/38 (68%), Positives = 29/38 (76%) Frame = -1 Query: 377 KRGMCLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRAN 264 +RGMC + +G F SHDVVKRRPVNCNTTHYRAN Sbjct: 3 ERGMCCKAIKLGNASVFRSHDVVKRRPVNCNTTHYRAN 40 Score = 28.3 bits (60), Expect = 3.8 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -2 Query: 376 KGECACKAIKLGNARVF 326 +G C CKAIKLGNA VF Sbjct: 4 RGMC-CKAIKLGNASVF 19 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 58.0 bits (134), Expect = 4e-09 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTASEL 289 KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 29 KGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGG 31 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 14 EGRSVRASSLLRQLAKGGCAARRL 37 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 58.0 bits (134), Expect = 4e-09 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTASEL 289 KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 241 KGGCAARRLSWVTPGFSQSRRCKTTASEL 269 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 216 HSPFRLRNCWEGRSVRASSLLRQLAKGG 243 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 226 EGRSVRASSLLRQLAKGGCAARRL 249 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 58.0 bits (134), Expect = 4e-09 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTASEL 289 KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 909 KGGCAARRLSWVTPGFSQSRRCKTTASEL 937 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 894 EGRSVRASSLLRQLAKGGCAARRL 917 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 58.0 bits (134), Expect = 4e-09 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTASEL 289 KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 58.0 bits (134), Expect = 4e-09 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTASEL 289 KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 21 KGGCAARRLSWVTPGFSQSRRCKTTASEL 49 Score = 33.1 bits (72), Expect = 0.13 Identities = 16/28 (57%), Positives = 20/28 (71%) Frame = -2 Query: 433 ATVGKGDRVRAFSLLRQLAKGECACKAI 350 A + +G VRA SLLRQLAKG CA + + Sbjct: 2 AQLWEGRSVRASSLLRQLAKGGCAARRL 29 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 58.0 bits (134), Expect = 4e-09 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTASEL 289 KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 396 KGGCAARRLSWVTPGFSQSRRCKTTASEL 424 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 371 HSPFRLRNCWEGRSVRASSLLRQLAKGG 398 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 381 EGRSVRASSLLRQLAKGGCAARRL 404 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 58.0 bits (134), Expect = 4e-09 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTASEL 289 KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 245 KGGCAARRLSWVTPGFSQSRRCKTTASEL 273 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 230 EGRSVRASSLLRQLAKGGCAARRL 253 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 58.0 bits (134), Expect = 4e-09 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTASEL 289 KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 312 KGGCAARRLSWVTPGFSQSRRCKTTASEL 340 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 287 HSPFRLRNCWEGRSVRASSLLRQLAKGG 314 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 297 EGRSVRASSLLRQLAKGGCAARRL 320 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 58.0 bits (134), Expect = 4e-09 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTASEL 289 KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 378 KGGCAARRLSWVTPGFSQSRRCKTTASEL 406 Score = 37.9 bits (84), Expect = 0.005 Identities = 18/33 (54%), Positives = 22/33 (66%) Frame = -2 Query: 448 PHSGCATVGKGDRVRAFSLLRQLAKGECACKAI 350 P+SG +G VRA SLLRQLAKG CA + + Sbjct: 354 PYSGLRNCWEGRSVRASSLLRQLAKGGCAARRL 386 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 58.0 bits (134), Expect = 4e-09 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTASEL 289 KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 70 KGGCAARRLSWVTPGFSQSRRCKTTASEL 98 Score = 34.7 bits (76), Expect = 0.044 Identities = 16/25 (64%), Positives = 19/25 (76%) Frame = -2 Query: 424 GKGDRVRAFSLLRQLAKGECACKAI 350 G+G VRA SLLRQLAKG CA + + Sbjct: 54 GEGRSVRASSLLRQLAKGGCAARRL 78 Score = 32.7 bits (71), Expect = 0.18 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 494 FNAIFTKILTLTICHSPFRLRNCWKGRSGAGLFVITPAGKRG 369 F F ++ HSPFRLRNC +GRS ++ K G Sbjct: 31 FAIAFHRLKNQGASHSPFRLRNCGEGRSVRASSLLRQLAKGG 72 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 58.0 bits (134), Expect = 4e-09 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTASEL 289 KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 29 KGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGG 31 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 14 EGRSVRASSLLRQLAKGGCAARRL 37 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 58.0 bits (134), Expect = 4e-09 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTASEL 289 KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 58.0 bits (134), Expect = 4e-09 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTASEL 289 KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 58.0 bits (134), Expect = 4e-09 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTASEL 289 KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 29 KGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGG 31 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 14 EGRSVRASSLLRQLAKGGCAARRL 37 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 58.0 bits (134), Expect = 4e-09 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTASEL 289 KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 29 KGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGG 31 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 14 EGRSVRASSLLRQLAKGGCAARRL 37 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 58.0 bits (134), Expect = 4e-09 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTASEL 289 KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 52 KGGCAARRLSWVTPGFSQSRRCKTTASEL 80 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 27 HSPFRLRNCWEGRSVRASSLLRQLAKGG 54 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 37 EGRSVRASSLLRQLAKGGCAARRL 60 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 58.0 bits (134), Expect = 4e-09 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTASEL 289 KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 288 KGGCAARRLSWVTPGFSQSRRCKTTASEL 316 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 273 EGRSVRASSLLRQLAKGGCAARRL 296 Score = 27.1 bits (57), Expect = 8.8 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -1 Query: 440 RLRNCWKGRSGAGLFVITPAGKRG 369 RLRNCW+GRS ++ K G Sbjct: 267 RLRNCWEGRSVRASSLLRQLAKGG 290 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 58.0 bits (134), Expect = 4e-09 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTASEL 289 KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 272 KGGCAARRLSWVTPGFSQSRRCKTTASEL 300 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 257 EGRSVRASSLLRQLAKGGCAARRL 280 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 58.0 bits (134), Expect = 4e-09 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTASEL 289 KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 58.0 bits (134), Expect = 4e-09 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTASEL 289 KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 261 KGGCAARRLSWVTPGFSQSRRCKTTASEL 289 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 246 EGRSVRASSLLRQLAKGGCAARRL 269 Score = 29.1 bits (62), Expect = 2.2 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 H RLRNCW+GRS ++ K G Sbjct: 236 HLTIRLRNCWEGRSVRASSLLRQLAKGG 263 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 58.0 bits (134), Expect = 4e-09 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTASEL 289 KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 286 KGGCAARRLSWVTPGFSQSRRCKTTASEL 314 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/39 (43%), Positives = 21/39 (53%) Frame = -1 Query: 485 IFTKILTLTICHSPFRLRNCWKGRSGAGLFVITPAGKRG 369 + T I HSPFRLRNCW+GRS ++ K G Sbjct: 250 VATNITIQGASHSPFRLRNCWEGRSVRASSLLRQLAKGG 288 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 271 EGRSVRASSLLRQLAKGGCAARRL 294 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 58.0 bits (134), Expect = 4e-09 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTASEL 289 KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 470 KGGCAARRLSWVTPGFSQSRRCKTTASEL 498 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 445 HSPFRLRNCWEGRSVRASSLLRQLAKGG 472 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 455 EGRSVRASSLLRQLAKGGCAARRL 478 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 58.0 bits (134), Expect = 4e-09 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTASEL 289 KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 139 KGGCAARRLSWVTPGFSQSRRCKTTASEL 167 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 124 EGRSVRASSLLRQLAKGGCAARRL 147 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 58.0 bits (134), Expect = 4e-09 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTASEL 289 KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 305 KGGCAARRLSWVTPGFSQSRRCKTTASEL 333 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 280 HSPFRLRNCWEGRSVRASSLLRQLAKGG 307 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 290 EGRSVRASSLLRQLAKGGCAARRL 313 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 58.0 bits (134), Expect = 4e-09 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTASEL 289 KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 155 KGGCAARRLSWVTPGFSQSRRCKTTASEL 183 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 130 HSPFRLRNCWEGRSVRASSLLRQLAKGG 157 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 140 EGRSVRASSLLRQLAKGGCAARRL 163 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 58.0 bits (134), Expect = 4e-09 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTASEL 289 KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 29 KGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGG 31 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 14 EGRSVRASSLLRQLAKGGCAARRL 37 >SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 58.0 bits (134), Expect = 4e-09 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTASEL 289 KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 348 KGGCAARRLSWVTPGFSQSRRCKTTASEL 376 Score = 32.7 bits (71), Expect = 0.18 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 KG VR +SLLRQL KG CA + + Sbjct: 333 KGRSVRTYSLLRQLVKGGCAARRL 356 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 58.0 bits (134), Expect = 4e-09 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTASEL 289 KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 29 KGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGG 31 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 14 EGRSVRASSLLRQLAKGGCAARRL 37 >SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 58.0 bits (134), Expect = 4e-09 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTASEL 289 KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 15 KGGCAARRLSWVTPGFSQSRRCKTTASEL 43 Score = 30.7 bits (66), Expect = 0.71 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -2 Query: 409 VRAFSLLRQLAKGECACKAI 350 VRA SLLRQLAKG CA + + Sbjct: 4 VRASSLLRQLAKGGCAARRL 23 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 58.0 bits (134), Expect = 4e-09 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTASEL 289 KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 214 KGGCAARRLSWVTPGFSQSRRCKTTASEL 242 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 199 EGRSVRASSLLRQLAKGGCAARRL 222 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 58.0 bits (134), Expect = 4e-09 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTASEL 289 KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 606 KGGCAARRLSWVTPGFSQSRRCKTTASEL 634 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 581 HSPFRLRNCWEGRSVRASSLLRQLAKGG 608 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 591 EGRSVRASSLLRQLAKGGCAARRL 614 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 58.0 bits (134), Expect = 4e-09 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTASEL 289 KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 242 KGGCAARRLSWVTPGFSQSRRCKTTASEL 270 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 227 EGRSVRASSLLRQLAKGGCAARRL 250 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 58.0 bits (134), Expect = 4e-09 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTASEL 289 KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 520 KGGCAARRLSWVTPGFSQSRRCKTTASEL 548 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 495 HSPFRLRNCWEGRSVRASSLLRQLAKGG 522 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 505 EGRSVRASSLLRQLAKGGCAARRL 528 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 58.0 bits (134), Expect = 4e-09 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTASEL 289 KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 103 KGGCAARRLSWVTPGFSQSRRCKTTASEL 131 Score = 34.3 bits (75), Expect = 0.058 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = -2 Query: 442 SGCATVGKGDRVRAFSLLRQLAKGECACKAI 350 SG +G VRA SLLRQLAKG CA + + Sbjct: 81 SGLRNCWEGRSVRASSLLRQLAKGGCAARRL 111 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 58.0 bits (134), Expect = 4e-09 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTASEL 289 KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 411 KGGCAARRLSWVTPGFSQSRRCKTTASEL 439 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 396 EGRSVRASSLLRQLAKGGCAARRL 419 Score = 27.1 bits (57), Expect = 8.8 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -1 Query: 440 RLRNCWKGRSGAGLFVITPAGKRG 369 RLRNCW+GRS ++ K G Sbjct: 390 RLRNCWEGRSVRASSLLRQLAKGG 413 >SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 58.0 bits (134), Expect = 4e-09 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTASEL 289 KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 15 KGGCAARRLSWVTPGFSQSRRCKTTASEL 43 Score = 30.7 bits (66), Expect = 0.71 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -2 Query: 409 VRAFSLLRQLAKGECACKAI 350 VRA SLLRQLAKG CA + + Sbjct: 4 VRASSLLRQLAKGGCAARRL 23 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 58.0 bits (134), Expect = 4e-09 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTASEL 289 KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 204 KGGCAARRLSWVTPGFSQSRRCKTTASEL 232 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 179 HSPFRLRNCWEGRSVRASSLLRQLAKGG 206 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 189 EGRSVRASSLLRQLAKGGCAARRL 212 >SB_15919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 57.6 bits (133), Expect = 5e-09 Identities = 23/27 (85%), Positives = 25/27 (92%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKR 372 HSPFRLRNCW+GR GAGLF ITPAG+R Sbjct: 43 HSPFRLRNCWEGRIGAGLFAITPAGER 69 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 57.2 bits (132), Expect = 7e-09 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTASEL*YDSL 274 KG ARRLSWVTPGFSQSRRCKTTASE D L Sbjct: 29 KGGCAARRLSWVTPGFSQSRRCKTTASEFPGDPL 62 Score = 52.8 bits (121), Expect = 2e-07 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = +2 Query: 296 LAVVLQRRDWENPGVTQLNRLASTFPF 376 LAVVLQRRDWENPGVTQLNRLA+ PF Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPPF 111 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGG 31 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = +3 Query: 357 LQAHSPFASWRNNEKARTRSP 419 L AH PFASWRN+E+ART P Sbjct: 105 LAAHPPFASWRNSEEARTDRP 125 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 14 EGRSVRASSLLRQLAKGGCAARRL 37 Score = 31.5 bits (68), Expect = 0.41 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 412 DRPFQQLRNLNGEW 453 DRP QQLR+LNGEW Sbjct: 123 DRPSQQLRSLNGEW 136 >SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 573 Score = 56.8 bits (131), Expect = 9e-09 Identities = 27/45 (60%), Positives = 32/45 (71%), Gaps = 1/45 (2%) Frame = -3 Query: 426 LERAIGCGP-FRYYASWQKGNVLARRLSWVTPGFSQSRRCKTTAS 295 + +A+G GP + + G ARRLSWVTPGFSQSRRCKTTAS Sbjct: 314 IRKAMGIGPGVQQQFKFTPGGCAARRLSWVTPGFSQSRRCKTTAS 358 >SB_25288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 56.4 bits (130), Expect = 1e-08 Identities = 30/53 (56%), Positives = 34/53 (64%) Frame = -3 Query: 453 PFPIQVAQLLERAIGCGPFRYYASWQKGNVLARRLSWVTPGFSQSRRCKTTAS 295 PF IQ A LL RAIG G F + ++G + ARRLSWV P FSQS RC AS Sbjct: 6 PFAIQAAHLLGRAIGAGLFDITPACERG-MCARRLSWVMPAFSQSSRCIMAAS 57 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 56.4 bits (130), Expect = 1e-08 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTASE 292 KG ARRLSWVTPGFSQSRRCKTTASE Sbjct: 551 KGGCAARRLSWVTPGFSQSRRCKTTASE 578 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 536 EGRSVRASSLLRQLAKGGCAARRL 559 Score = 27.1 bits (57), Expect = 8.8 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -1 Query: 440 RLRNCWKGRSGAGLFVITPAGKRG 369 RLRNCW+GRS ++ K G Sbjct: 530 RLRNCWEGRSVRASSLLRQLAKGG 553 >SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 55.2 bits (127), Expect = 3e-08 Identities = 28/50 (56%), Positives = 31/50 (62%) Frame = +2 Query: 227 YCCHTLEGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLASTFPF 376 +CC G P+ LAVVLQRRDWENPGVTQLNRLA+ PF Sbjct: 29 FCCQKRYGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPF 76 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = +3 Query: 357 LQAHSPFASWRNNEKARTRSP 419 L AH PFASWRN+E+ART P Sbjct: 70 LAAHPPFASWRNSEEARTDRP 90 Score = 33.9 bits (74), Expect = 0.077 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = +1 Query: 412 DRPFQQLRNLNGEWQIVSVNILVKI 486 DRP QQLR+LNGEW+++ +L + Sbjct: 88 DRPSQQLRSLNGEWRLMRYFLLTHL 112 >SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) Length = 742 Score = 55.2 bits (127), Expect = 3e-08 Identities = 36/78 (46%), Positives = 44/78 (56%), Gaps = 4/78 (5%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTASE----L*YDSL*GELGTGPPSRV*QQYNIKFSL 208 KG ARRLSWVTPGFSQSRRCKTTAS L DS G G ++ Q N++ L Sbjct: 507 KGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSR-GSPKQGKSNKEVQNANLQTPL 565 Query: 207 ALQSAEVYTIIRTIVVSE 154 L +T + ++V E Sbjct: 566 HLAVERQHTQVVRLLVRE 583 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 492 EGRSVRASSLLRQLAKGGCAARRL 515 Score = 27.1 bits (57), Expect = 8.8 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -1 Query: 440 RLRNCWKGRSGAGLFVITPAGKRG 369 RLRNCW+GRS ++ K G Sbjct: 486 RLRNCWEGRSVRASSLLRQLAKGG 509 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 55.2 bits (127), Expect = 3e-08 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = +3 Query: 294 HWPSFYNVVTGKTLALPNLIALQAHSPFA 380 HWPSFYNVVTGKTLALPNLIALQ H P + Sbjct: 62 HWPSFYNVVTGKTLALPNLIALQ-HIPLS 89 Score = 36.3 bits (80), Expect = 0.014 Identities = 17/29 (58%), Positives = 18/29 (62%) Frame = +1 Query: 325 GKPWRYPT*SPCKHIPLLPAGVITKRPAP 411 GK P +HIPL PAGVI KRPAP Sbjct: 72 GKTLALPNLIALQHIPLSPAGVIAKRPAP 100 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 55.2 bits (127), Expect = 3e-08 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = +3 Query: 294 HWPSFYNVVTGKTLALPNLIALQAHSPFA 380 HWPSFYNVVTGKTLALPNLIALQ H P + Sbjct: 57 HWPSFYNVVTGKTLALPNLIALQ-HIPLS 84 Score = 36.3 bits (80), Expect = 0.014 Identities = 17/29 (58%), Positives = 18/29 (62%) Frame = +1 Query: 325 GKPWRYPT*SPCKHIPLLPAGVITKRPAP 411 GK P +HIPL PAGVI KRPAP Sbjct: 67 GKTLALPNLIALQHIPLSPAGVIAKRPAP 95 >SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 54.8 bits (126), Expect = 4e-08 Identities = 28/53 (52%), Positives = 32/53 (60%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRGMCLQGD*VG*RQGFPSHDVVKRRPV 294 HSPFRLRNCW+GRS ++ K G + GFPSHDVVKRRPV Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAAR----RLSWGFPSHDVVKRRPV 67 >SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) Length = 532 Score = 54.8 bits (126), Expect = 4e-08 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = +3 Query: 357 LQAHSPFASWRNNEKARTRSPFPTVAQPEWGM 452 L AH PFASWRN+E+ RSPFPTVAQPEW M Sbjct: 364 LAAHPPFASWRNSERPH-RSPFPTVAQPEWRM 394 Score = 46.4 bits (105), Expect = 1e-05 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = +2 Query: 308 LQRRDWENPGVTQLNRLASTFPF 376 LQRRDWENPGVTQLNRLA+ PF Sbjct: 348 LQRRDWENPGVTQLNRLAAHPPF 370 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 497 KGGCAARRLSWVTPGFSQSRRCKTTAS 523 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 472 HSPFRLRNCWEGRSVRASSLLRQLAKGG 499 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 482 EGRSVRASSLLRQLAKGGCAARRL 505 >SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGG 46 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRL 52 >SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) Length = 212 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 167 KGGCAARRLSWVTPGFSQSRRCKTTAS 193 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 152 EGRSVRASSLLRQLAKGGCAARRL 175 >SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 244 KGGCAARRLSWVTPGFSQSRRCKTTAS 270 Score = 33.1 bits (72), Expect = 0.13 Identities = 16/31 (51%), Positives = 20/31 (64%) Frame = -2 Query: 442 SGCATVGKGDRVRAFSLLRQLAKGECACKAI 350 +G +G VRA SLLRQLAKG CA + + Sbjct: 222 TGLRNCWEGRSVRASSLLRQLAKGGCAARRL 252 >SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 388 KGGCAARRLSWVTPGFSQSRRCKTTAS 414 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 373 EGRSVRASSLLRQLAKGGCAARRL 396 >SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGG 46 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRL 52 >SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 90 KGGCAARRLSWVTPGFSQSRRCKTTAS 116 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 65 HSPFRLRNCWEGRSVRASSLLRQLAKGG 92 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 75 EGRSVRASSLLRQLAKGGCAARRL 98 >SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGG 46 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRL 52 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 671 KGGCAARRLSWVTPGFSQSRRCKTTAS 697 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 646 HSPFRLRNCWEGRSVRASSLLRQLAKGG 673 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 656 EGRSVRASSLLRQLAKGGCAARRL 679 >SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_48895| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 829 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 177 KGGCAARRLSWVTPGFSQSRRCKTTAS 203 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGG 46 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRL 52 >SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) Length = 388 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) Length = 305 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) Length = 154 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 54.4 bits (125), Expect = 5e-08 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTASEL 289 KG ARRLSWVTP FSQSRRCKTTASEL Sbjct: 21 KGGCAARRLSWVTPVFSQSRRCKTTASEL 49 Score = 33.1 bits (72), Expect = 0.13 Identities = 16/28 (57%), Positives = 20/28 (71%) Frame = -2 Query: 433 ATVGKGDRVRAFSLLRQLAKGECACKAI 350 A + +G VRA SLLRQLAKG CA + + Sbjct: 2 AQLWEGRSVRASSLLRQLAKGGCAARRL 29 >SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGG 46 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRL 52 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 580 KGGCAARRLSWVTPGFSQSRRCKTTAS 606 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 555 HSPFRLRNCWEGRSVRASSLLRQLAKGG 582 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 565 EGRSVRASSLLRQLAKGGCAARRL 588 >SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) Length = 666 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 427 KGGCAARRLSWVTPGFSQSRRCKTTAS 453 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 412 EGRSVRASSLLRQLAKGGCAARRL 435 >SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) Length = 128 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) Length = 794 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGG 46 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRL 52 >SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGG 46 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRL 52 >SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 54 KGGCAARRLSWVTPGFSQSRRCKTTAS 80 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 39 EGRSVRASSLLRQLAKGGCAARRL 62 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 810 KGGCAARRLSWVTPGFSQSRRCKTTAS 836 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 795 EGRSVRASSLLRQLAKGGCAARRL 818 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGG 46 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRL 52 >SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) Length = 631 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 471 KGGCAARRLSWVTPGFSQSRRCKTTAS 497 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 456 EGRSVRASSLLRQLAKGGCAARRL 479 >SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGG 46 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRL 52 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGG 46 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRL 52 >SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 90 KGGCAARRLSWVTPGFSQSRRCKTTAS 116 Score = 32.7 bits (71), Expect = 0.18 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRN W+GRS ++ K G Sbjct: 65 HSPFRLRNYWEGRSVRASSLLRQLAKGG 92 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 75 EGRSVRASSLLRQLAKGGCAARRL 98 >SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGG 46 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRL 52 >SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) Length = 214 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 534 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 392 KGGCAARRLSWVTPGFSQSRRCKTTAS 418 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 377 EGRSVRASSLLRQLAKGGCAARRL 400 >SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) Length = 1232 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 1126 KGGCAARRLSWVTPGFSQSRRCKTTAS 1152 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 1111 EGRSVRASSLLRQLAKGGCAARRL 1134 Score = 27.1 bits (57), Expect = 8.8 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -1 Query: 440 RLRNCWKGRSGAGLFVITPAGKRG 369 RLRNCW+GRS ++ K G Sbjct: 1105 RLRNCWEGRSVRASSLLRQLAKGG 1128 >SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) Length = 412 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 317 KGGCAARRLSWVTPGFSQSRRCKTTAS 343 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 302 EGRSVRASSLLRQLAKGGCAARRL 325 >SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1758 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 131 KGGCAARRLSWVTPGFSQSRRCKTTAS 157 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 116 EGRSVRASSLLRQLAKGGCAARRL 139 Score = 27.1 bits (57), Expect = 8.8 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -1 Query: 440 RLRNCWKGRSGAGLFVITPAGKRG 369 RLRNCW+GRS ++ K G Sbjct: 110 RLRNCWEGRSVRASSLLRQLAKGG 133 >SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 41 KGGCAARRLSWVTPGFSQSRRCKTTAS 67 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 26 EGRSVRASSLLRQLAKGGCAARRL 49 >SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_24322| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 3 KGGCAARRLSWVTPGFSQSRRCKTTAS 29 >SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 KGGCAARRLSWVTPGFSQSRRCKTTAS 41 Score = 30.7 bits (66), Expect = 0.71 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -2 Query: 409 VRAFSLLRQLAKGECACKAI 350 VRA SLLRQLAKG CA + + Sbjct: 4 VRASSLLRQLAKGGCAARRL 23 >SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) Length = 466 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGG 46 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRL 52 >SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGG 46 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRL 52 >SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) Length = 230 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 57 KGGCAARRLSWVTPGFSQSRRCKTTAS 83 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGG 59 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 42 EGRSVRASSLLRQLAKGGCAARRL 65 >SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGG 46 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRL 52 >SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGG 46 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRL 52 >SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGG 46 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRL 52 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGG 46 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRL 52 >SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) Length = 184 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 115 KGGCAARRLSWVTPGFSQSRRCKTTAS 141 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 100 EGRSVRASSLLRQLAKGGCAARRL 123 Score = 27.1 bits (57), Expect = 8.8 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -1 Query: 440 RLRNCWKGRSGAGLFVITPAGKRG 369 RLRNCW+GRS ++ K G Sbjct: 94 RLRNCWEGRSVRASSLLRQLAKGG 117 >SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 75 KGGCAARRLSWVTPGFSQSRRCKTTAS 101 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 60 EGRSVRASSLLRQLAKGGCAARRL 83 Score = 27.1 bits (57), Expect = 8.8 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -1 Query: 440 RLRNCWKGRSGAGLFVITPAGKRG 369 RLRNCW+GRS ++ K G Sbjct: 54 RLRNCWEGRSVRASSLLRQLAKGG 77 >SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.7 bits (71), Expect = 0.18 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA+SL RQLAKG CA + + Sbjct: 7 EGRSVRAYSLFRQLAKGGCAARRL 30 >SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 77 KGGCAARRLSWVTPGFSQSRRCKTTAS 103 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 62 EGRSVRASSLLRQLAKGGCAARRL 85 Score = 28.3 bits (60), Expect = 3.8 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 2/35 (5%) Frame = -1 Query: 467 TLTICHSPF--RLRNCWKGRSGAGLFVITPAGKRG 369 TL H+P RLRNCW+GRS ++ K G Sbjct: 45 TLAERHAPQAPRLRNCWEGRSVRASSLLRQLAKGG 79 >SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGG 46 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRL 52 >SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 71 KGGCAARRLSWVTPGFSQSRRCKTTAS 97 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 56 EGRSVRASSLLRQLAKGGCAARRL 79 >SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) Length = 90 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) Length = 542 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 176 KGGCAARRLSWVTPGFSQSRRCKTTAS 202 Score = 33.1 bits (72), Expect = 0.13 Identities = 16/31 (51%), Positives = 20/31 (64%) Frame = -2 Query: 442 SGCATVGKGDRVRAFSLLRQLAKGECACKAI 350 +G +G VRA SLLRQLAKG CA + + Sbjct: 154 TGLRNCWEGRSVRASSLLRQLAKGGCAARRL 184 >SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) Length = 546 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGG 46 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRL 52 >SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGG 46 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRL 52 >SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) Length = 338 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGG 46 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRL 52 >SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) Length = 427 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGG 46 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRL 52 >SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGG 46 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRL 52 >SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 36 KGGCAARRLSWVTPGFSQSRRCKTTAS 62 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 11 HSPFRLRNCWEGRSVRASSLLRQLAKGG 38 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 21 EGRSVRASSLLRQLAKGGCAARRL 44 >SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) Length = 220 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) Length = 172 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGG 46 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRL 52 >SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGG 46 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRL 52 >SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) Length = 316 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) Length = 253 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 213 KGGCAARRLSWVTPGFSQSRRCKTTAS 239 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 188 HSPFRLRNCWEGRSVRASSLLRQLAKGG 215 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 198 EGRSVRASSLLRQLAKGGCAARRL 221 >SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 149 KGGCAARRLSWVTPGFSQSRRCKTTAS 175 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 134 EGRSVRASSLLRQLAKGGCAARRL 157 >SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) Length = 195 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGG 46 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRL 52 >SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) Length = 250 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) Length = 283 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 120 KGGCAARRLSWVTPGFSQSRRCKTTAS 146 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 105 EGRSVRASSLLRQLAKGGCAARRL 128 >SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGG 46 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRL 52 >SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGG 46 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRL 52 >SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 849 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 76 KGGCAARRLSWVTPGFSQSRRCKTTAS 102 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 61 EGRSVRASSLLRQLAKGGCAARRL 84 >SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRL 30 >SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGG 46 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRL 52 >SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) Length = 144 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGG 46 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRL 52 >SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 375 KGNVLARRLSWVTPGFSQSRRCKTTAS 295 KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 452 HSPFRLRNCWKGRSGAGLFVITPAGKRG 369 HSPFRLRNCW+GRS ++ K G Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGG 46 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 421 KGDRVRAFSLLRQLAKGECACKAI 350 +G VRA SLLRQLAKG CA + + Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRL 52 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,351,942 Number of Sequences: 59808 Number of extensions: 419903 Number of successful extensions: 12174 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5287 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12104 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1099461690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -