BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0095 (594 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. 168 4e-44 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 6.9 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 21 6.9 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 21 6.9 L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. 21 9.1 AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 prot... 21 9.1 >AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. Length = 133 Score = 168 bits (408), Expect = 4e-44 Identities = 81/97 (83%), Positives = 87/97 (89%), Gaps = 1/97 (1%) Frame = -1 Query: 594 FQPSFLGMKACGIHEPTYNSIIKCDVDIRRT*RQPGIVRW-TTMYPGIADRMQKEITALA 418 FQPSFLGM+ACGIHE TYNSI+KCDVDIR+ ++ TTMYPGIADRMQKEITALA Sbjct: 37 FQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALA 96 Query: 417 PSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS 307 PSTMKIKIIAPPE+KYSVWIGGSILASLSTFQQMWIS Sbjct: 97 PSTMKIKIIAPPEKKYSVWIGGSILASLSTFQQMWIS 133 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.4 bits (43), Expect = 6.9 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = -1 Query: 477 WTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYS 367 W T I + +I ALAPS IA + K++ Sbjct: 1251 WVTASTNIGEGEASKIVALAPSVRVPAKIASFDDKFT 1287 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 21.4 bits (43), Expect = 6.9 Identities = 6/12 (50%), Positives = 8/12 (66%) Frame = -3 Query: 475 DHHVPWNRRPYA 440 DHH+ WN +A Sbjct: 64 DHHLKWNASEFA 75 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 21.4 bits (43), Expect = 6.9 Identities = 13/50 (26%), Positives = 23/50 (46%) Frame = -1 Query: 486 IVRWTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILAS 337 IV ++ PG + M+++ AL + ++ RKY V I A+ Sbjct: 389 IVEFSKRLPGFDELMREDQIALLKACSSEVMMLRMARKYDVQTDSIIFAN 438 >L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. Length = 382 Score = 21.0 bits (42), Expect = 9.1 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = -1 Query: 327 FQQMWISKQEYDESGPSIVHRK 262 F+Q W S Q Y + +V R+ Sbjct: 151 FRQNWASLQPYKKLSVEVVRRE 172 >AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 protein. Length = 232 Score = 21.0 bits (42), Expect = 9.1 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = +1 Query: 490 GLASSSSDVHVALYD--GVICGLVDAASFHSQERR 588 G S + +A+ + G+IC L A S + ERR Sbjct: 194 GTVFGSVAIAIAIVELIGIICALCLANSIKNAERR 228 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,443 Number of Sequences: 438 Number of extensions: 4038 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17359926 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -