BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0092 (585 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 22 3.9 AB178034-1|BAD27112.1| 76|Apis mellifera apiceropsin protein. 22 3.9 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 22 5.1 AF134817-1|AAD40233.1| 105|Apis mellifera FABP-like protein pro... 22 5.1 AB083011-1|BAC54132.1| 135|Apis mellifera fatty acid binding pr... 22 5.1 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 22.2 bits (45), Expect = 3.9 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 443 LAWRRLTPQTIQGLVFSGICCFIKNLPFFPRWG 541 +AW TP + + FSGI +K P F WG Sbjct: 289 MAW---TPYLV--INFSGIFNLVKISPLFTIWG 316 >AB178034-1|BAD27112.1| 76|Apis mellifera apiceropsin protein. Length = 76 Score = 22.2 bits (45), Expect = 3.9 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 443 LAWRRLTPQTIQGLVFSGICCFIKNLPFFPRWG 541 +AW TP + + FSGI +K P F WG Sbjct: 39 MAW---TPYLV--INFSGIFNLVKISPLFTIWG 66 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 21.8 bits (44), Expect = 5.1 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -3 Query: 265 WQGFSFEGLPIRRLHPLIV 209 + GF++EGL R L P I+ Sbjct: 626 FDGFNWEGLRARTLEPPIM 644 >AF134817-1|AAD40233.1| 105|Apis mellifera FABP-like protein protein. Length = 105 Score = 21.8 bits (44), Expect = 5.1 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +2 Query: 221 VKSSDGKTFKTET 259 V S +G TFKTET Sbjct: 82 VTSIEGNTFKTET 94 >AB083011-1|BAC54132.1| 135|Apis mellifera fatty acid binding protein protein. Length = 135 Score = 21.8 bits (44), Expect = 5.1 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +2 Query: 221 VKSSDGKTFKTET 259 V S +G TFKTET Sbjct: 84 VTSIEGNTFKTET 96 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,207 Number of Sequences: 438 Number of extensions: 3512 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16993167 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -