BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0090 (605 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40798| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_6174| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 6e-13 SB_44784| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_8963| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_39045| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_29439| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_52358| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_48779| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_46560| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_44599| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_41858| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_30495| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_24853| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_15774| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_15546| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_7830| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_1857| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_58644| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_58116| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_55687| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_55314| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_54229| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_53524| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_53359| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_49581| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_46357| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_44808| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_41634| Best HMM Match : DUF1518 (HMM E-Value=5.9) 70 2e-12 SB_39956| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_37493| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_29382| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_16989| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_16792| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_13902| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_12205| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_7277| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_6814| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_4334| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_2347| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_2215| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_1811| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_41249| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 2e-12 SB_35268| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 2e-12 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 2e-12 SB_42078| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 3e-12 SB_26100| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 3e-12 SB_3778| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 3e-12 SB_58070| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 3e-12 SB_50881| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 3e-12 SB_44160| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 3e-12 SB_37446| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 3e-12 SB_12263| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 3e-12 SB_11405| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 4e-12 SB_5558| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 4e-12 SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8) 68 5e-12 SB_59787| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_59379| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_59234| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_58491| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_57948| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_56753| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_53500| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_53114| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_52245| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_51644| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_51062| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_48392| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_46317| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_46056| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_46043| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_44153| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 68 7e-12 SB_44051| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_43906| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_42917| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_41356| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_40472| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_39541| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_39300| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_38833| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_37911| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_37424| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_37302| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_37110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 68 7e-12 SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 68 7e-12 SB_33667| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_33364| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_31814| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_30660| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_30006| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_29366| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_27748| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_27084| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_27021| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_26273| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_26010| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_25546| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_24341| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_23921| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_19588| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_19288| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_18833| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_18210| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_18149| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_17336| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_15920| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 68 7e-12 SB_15538| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_14422| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_13971| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_12408| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_12224| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_11305| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_11121| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_7698| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_6536| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_4627| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_4362| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_550| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_527| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 68 7e-12 SB_59314| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 68 7e-12 SB_58870| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_58253| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_57993| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_54803| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_53700| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_53306| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_53021| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_52780| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_51768| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_51582| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_51426| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 68 7e-12 SB_50985| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_50975| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_49521| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_49109| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_47871| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_45833| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_45139| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_44724| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_42353| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_42008| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_41961| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_41130| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_40711| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_40110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 68 7e-12 SB_39752| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_39077| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_37191| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_36226| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_34914| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_34567| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_34080| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_33471| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_31864| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_29675| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_28321| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_27775| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_27330| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_26901| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_26760| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_26472| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_26164| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_25733| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_24943| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_22336| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_22065| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 68 7e-12 SB_21160| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_20762| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_19810| Best HMM Match : Cathelicidins (HMM E-Value=4.8) 68 7e-12 SB_19474| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_19236| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_19110| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_19089| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_18734| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_18260| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_17829| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_17440| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_16931| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_14957| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_14440| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_14017| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_11334| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_10849| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_6271| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_5929| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_5657| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_5275| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_4697| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_4589| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_4504| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_4388| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_3842| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_3072| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_2183| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_2030| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_1600| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_1514| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_626| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_25780| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 9e-12 SB_15901| Best HMM Match : Defensin_1 (HMM E-Value=8.6) 67 9e-12 SB_29170| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 9e-12 SB_29105| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 9e-12 SB_10006| Best HMM Match : 7tm_1 (HMM E-Value=0.0022) 67 9e-12 SB_48030| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_46148| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_39402| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 67 1e-11 SB_25677| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_16953| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_14500| Best HMM Match : Vicilin_N (HMM E-Value=5.3) 66 2e-11 SB_2991| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_55151| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 66 2e-11 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_5999| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_57544| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_46002| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 5e-11 SB_5290| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 5e-11 SB_41530| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 5e-11 SB_23689| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 6e-11 SB_48541| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 8e-11 SB_12204| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 8e-11 SB_55223| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 8e-11 SB_25347| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 8e-11 SB_17175| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 8e-11 SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) 63 1e-10 SB_29399| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_38201| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_37577| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_9828| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_54766| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_46053| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_34291| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_15129| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_1430| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 51 8e-07 SB_5943| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_49932| Best HMM Match : DUF1518 (HMM E-Value=4.9) 42 5e-04 SB_44744| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_41893| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_23757| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_18142| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_27417| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) 33 0.18 SB_12021| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_22731| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.31 SB_57695| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.55 SB_33090| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.96 SB_21833| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.96 SB_57686| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_48951| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_49552| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_47505| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_37312| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_57449| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_56517| Best HMM Match : CUB (HMM E-Value=0.0011) 29 2.9 SB_53282| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_13724| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_10665| Best HMM Match : PT (HMM E-Value=6.2) 29 2.9 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_59705| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_59162| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_58689| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_58471| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_57504| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_57309| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_57160| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_57088| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_57000| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_56985| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_56864| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_56097| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_55911| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_55353| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_54657| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_54057| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_53941| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_53667| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_53456| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_53229| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_52843| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_51637| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_51120| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_51074| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_51032| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_51007| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_50996| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_50982| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_50953| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_50936| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_50384| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_50220| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_49746| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_49667| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_49646| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_49638| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_49334| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_49116| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_49113| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_49028| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_48983| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_48970| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_48539| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_48364| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_47957| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_47808| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_47729| Best HMM Match : ASC (HMM E-Value=1.8e-07) 29 3.9 SB_47385| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_47361| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_47000| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_46654| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_46429| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_46359| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_46213| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_45478| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_45234| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_44852| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_44662| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_43993| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_43758| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_43593| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_43340| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_43144| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_43093| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_42443| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_42383| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_42278| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_42126| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_41977| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_40549| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_40449| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_40443| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_40197| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_39975| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_39947| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_39754| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_39490| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_38568| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_38390| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_38374| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_38338| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_38296| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_37924| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_37621| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_37575| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_37514| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_36927| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_36111| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_35639| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_35629| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_35549| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_35413| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_35273| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_35215| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_35079| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_34965| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_34867| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_34812| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_34787| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_34475| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_34273| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_34020| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_34019| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_33900| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_33633| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_33363| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_33156| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_33065| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_32699| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_32249| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_31827| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_31689| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_31560| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_31456| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_31442| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_31298| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_31283| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_31155| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_31061| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_30878| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_29626| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_29443| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_28945| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_28854| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_28678| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_28435| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_27744| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_27513| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_27344| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_26541| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_26180| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_26102| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_26045| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_25987| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_25886| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_24955| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_24149| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_24008| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_23901| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_23701| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_23491| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_23324| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_23308| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_23301| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_23277| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_22929| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_22512| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_22481| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_22451| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_21947| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_21159| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_21030| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_20944| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_20880| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_20832| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_20742| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_20690| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_20420| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_20060| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_20036| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_19743| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_19490| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_19448| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_18813| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_18603| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_18478| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_18315| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_17938| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_17616| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_17417| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_17352| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_17230| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_16690| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_16230| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_15921| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_15429| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_15370| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_14040| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_13500| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_12864| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_12842| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_12053| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_12049| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_11704| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_11587| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_11380| Best HMM Match : Cathelicidins (HMM E-Value=9.6) 29 3.9 SB_10981| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_10838| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_10043| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_9790| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_9789| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_9564| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_9236| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_9227| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_9169| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_8203| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_8131| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_7699| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_7316| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_7204| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_6994| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_6265| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_6232| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_6109| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_6103| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_5995| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_5987| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_5937| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_5666| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_5533| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_4915| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_4853| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_4538| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_4213| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_4133| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_3630| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_3555| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_3396| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_3272| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_3008| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_2936| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_2741| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_2242| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_1859| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_1767| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_1708| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_1630| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_1626| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_1413| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_1202| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_1184| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_620| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_597| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_141| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_59761| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_59213| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_59171| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_58958| Best HMM Match : Baculo_PEP_C (HMM E-Value=0.35) 29 3.9 SB_58614| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 >SB_40798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 40/84 (47%), Positives = 49/84 (58%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + +S EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F S+ + RTP ++ C Sbjct: 79 RKSMSSPNFQGSSRAHRTPQEVWC 102 >SB_6174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 71.3 bits (167), Expect = 6e-13 Identities = 40/87 (45%), Positives = 49/87 (56%), Gaps = 1/87 (1%) Frame = -1 Query: 443 PDRAPGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRT 267 P +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG Sbjct: 19 PRASPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEY 76 Query: 266 GATSHVHPSREFSRSAESIRTPPQMRC 186 T S F S+ + RTP ++ C Sbjct: 77 DRTRKSMSSPNFQGSSRAHRTPQEVWC 103 >SB_44784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 70.5 bits (165), Expect = 1e-12 Identities = 39/84 (46%), Positives = 49/84 (58%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S +F S+ + RTP ++ C Sbjct: 79 RKSMSSPDFQGSSRAHRTPQEVWC 102 >SB_8963| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 70.5 bits (165), Expect = 1e-12 Identities = 42/95 (44%), Positives = 52/95 (54%), Gaps = 1/95 (1%) Frame = -3 Query: 432 TGPHPLPVQTRHA-PVLRANPYSEVTDPICRLPLPTLFYRLEALHLGDLLRNMGTNRRDI 256 +GP PL P LRANP+ EVTD CRLPLPTLFY+ EA HLGDLLR + R D Sbjct: 63 SGPGPLASSLSPTDPTLRANPFPEVTDLFCRLPLPTLFYQPEAAHLGDLLRLL--VRPDT 120 Query: 255 SRTSLT*IFKVRREYPDTAANAVLFAFRTISPFYR 151 + PDT + V+ +R ++P R Sbjct: 121 KINVFPEFSRAVESAPDTTRSVVV--YRALNPISR 153 >SB_39045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 70.1 bits (164), Expect = 1e-12 Identities = 40/87 (45%), Positives = 48/87 (55%), Gaps = 1/87 (1%) Frame = -1 Query: 443 PDRAPGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRT 267 P APGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG Sbjct: 19 PRPAPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEY 76 Query: 266 GATSHVHPSREFSRSAESIRTPPQMRC 186 T S F + + RTP ++ C Sbjct: 77 DRTRKSMSSPNFQGPSRAHRTPQEVWC 103 >SB_29439| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 70.1 bits (164), Expect = 1e-12 Identities = 39/84 (46%), Positives = 49/84 (58%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 10 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 67 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S FS ++ + RTP ++ C Sbjct: 68 RKSMSSPNFSGASRAHRTPQEVWC 91 >SB_52358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 69.7 bits (163), Expect = 2e-12 Identities = 39/84 (46%), Positives = 48/84 (57%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F S+ + RTP ++ C Sbjct: 79 RKSMSSPNFQGSSRAHRTPQEVWC 102 >SB_48779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 69.7 bits (163), Expect = 2e-12 Identities = 39/84 (46%), Positives = 48/84 (57%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F S+ + RTP ++ C Sbjct: 79 RKSMSSPNFQGSSRAHRTPQEVWC 102 >SB_46560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 69.7 bits (163), Expect = 2e-12 Identities = 39/84 (46%), Positives = 48/84 (57%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F S+ + RTP ++ C Sbjct: 79 RKSMSSPNFQGSSRAHRTPQEVWC 102 >SB_44599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 69.7 bits (163), Expect = 2e-12 Identities = 39/84 (46%), Positives = 48/84 (57%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 22 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 79 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F S+ + RTP ++ C Sbjct: 80 RKSMSSPNFQGSSRAHRTPQEVWC 103 >SB_41858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 69.7 bits (163), Expect = 2e-12 Identities = 39/84 (46%), Positives = 48/84 (57%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F S+ + RTP ++ C Sbjct: 79 RKSMSSPNFQGSSRAHRTPQEVWC 102 >SB_30495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 69.7 bits (163), Expect = 2e-12 Identities = 39/84 (46%), Positives = 48/84 (57%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F S+ + RTP ++ C Sbjct: 79 RKSMSSPNFQGSSRAHRTPQEVWC 102 >SB_24853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 69.7 bits (163), Expect = 2e-12 Identities = 39/84 (46%), Positives = 48/84 (57%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F S+ + RTP ++ C Sbjct: 79 RKSMSSPNFQGSSRAHRTPQEVWC 102 >SB_15774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 69.7 bits (163), Expect = 2e-12 Identities = 39/84 (46%), Positives = 48/84 (57%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F S+ + RTP ++ C Sbjct: 79 RKSMSSPNFQGSSRAHRTPQEVWC 102 >SB_15546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 69.7 bits (163), Expect = 2e-12 Identities = 39/84 (46%), Positives = 48/84 (57%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F S+ + RTP ++ C Sbjct: 79 RKSMSSPNFQGSSRAHRTPQEVWC 102 >SB_7830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 69.7 bits (163), Expect = 2e-12 Identities = 39/84 (46%), Positives = 48/84 (57%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + +S EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_1857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 69.7 bits (163), Expect = 2e-12 Identities = 39/84 (46%), Positives = 48/84 (57%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F S+ + RTP ++ C Sbjct: 79 RKSMSSPNFQGSSRAHRTPQEVWC 102 >SB_58644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 69.7 bits (163), Expect = 2e-12 Identities = 39/84 (46%), Positives = 48/84 (57%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F S+ + RTP ++ C Sbjct: 79 RKSMSSPNFQGSSRAHRTPQEVWC 102 >SB_58116| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 69.7 bits (163), Expect = 2e-12 Identities = 39/84 (46%), Positives = 48/84 (57%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F S+ + RTP ++ C Sbjct: 79 RKSMSSPNFQGSSRAHRTPQEVWC 102 >SB_55687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 69.7 bits (163), Expect = 2e-12 Identities = 39/84 (46%), Positives = 48/84 (57%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + +S EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_55314| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 69.7 bits (163), Expect = 2e-12 Identities = 39/84 (46%), Positives = 48/84 (57%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F S+ + RTP ++ C Sbjct: 79 RKSMSSPNFQGSSRAHRTPQEVWC 102 >SB_54229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 69.7 bits (163), Expect = 2e-12 Identities = 39/84 (46%), Positives = 48/84 (57%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F S+ + RTP ++ C Sbjct: 79 RKSMSSPNFQGSSRAHRTPQEVWC 102 >SB_53524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 69.7 bits (163), Expect = 2e-12 Identities = 39/84 (46%), Positives = 48/84 (57%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F S+ + RTP ++ C Sbjct: 79 RKSMSSPNFQGSSRAHRTPQEVWC 102 >SB_53359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 69.7 bits (163), Expect = 2e-12 Identities = 39/84 (46%), Positives = 48/84 (57%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 10 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 67 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F S+ + RTP ++ C Sbjct: 68 RKSMSSPNFQGSSRAHRTPQEVWC 91 >SB_49581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 69.7 bits (163), Expect = 2e-12 Identities = 39/84 (46%), Positives = 48/84 (57%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F S+ + RTP ++ C Sbjct: 79 RKSMSSPNFQGSSRAHRTPQEVWC 102 >SB_46357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 69.7 bits (163), Expect = 2e-12 Identities = 39/84 (46%), Positives = 48/84 (57%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F S+ + RTP ++ C Sbjct: 79 RKSMSSPNFQGSSRAHRTPQEVWC 102 >SB_44808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 69.7 bits (163), Expect = 2e-12 Identities = 39/84 (46%), Positives = 48/84 (57%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + +S EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_41634| Best HMM Match : DUF1518 (HMM E-Value=5.9) Length = 321 Score = 69.7 bits (163), Expect = 2e-12 Identities = 39/82 (47%), Positives = 46/82 (56%) Frame = -1 Query: 431 PGRIRFPSKPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGATSH 252 PG + P P + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 239 PGPLASSLSPTDP-TLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRTRK 295 Query: 251 VHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 296 SMSSPNFQGPSRAHRTPQEVWC 317 >SB_39956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 69.7 bits (163), Expect = 2e-12 Identities = 39/84 (46%), Positives = 48/84 (57%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 10 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 67 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F S+ + RTP ++ C Sbjct: 68 RKSMSSPNFQGSSRAHRTPQEVWC 91 >SB_37493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 69.7 bits (163), Expect = 2e-12 Identities = 39/84 (46%), Positives = 48/84 (57%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 10 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 67 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F S+ + RTP ++ C Sbjct: 68 RKSMSSPNFQGSSRAHRTPQEVWC 91 >SB_29382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 69.7 bits (163), Expect = 2e-12 Identities = 39/84 (46%), Positives = 48/84 (57%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F S+ + RTP ++ C Sbjct: 79 RKSMSSPNFQGSSRAHRTPQEVWC 102 >SB_16989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 69.7 bits (163), Expect = 2e-12 Identities = 39/84 (46%), Positives = 49/84 (58%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + +S EPIL PKLRI FADFPYLH SI+ RL TLETCCG Sbjct: 21 SPGRVHWLQVSARQTQSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRK 80 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S P+ F + + RTP ++ C Sbjct: 81 SMSFPN--FQGPSRAHRTPQEVWC 102 >SB_16792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 69.7 bits (163), Expect = 2e-12 Identities = 37/83 (44%), Positives = 47/83 (56%) Frame = -1 Query: 434 APGRIRFPSKPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGATS 255 +PGR+ + + +PIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTNLKPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRTR 78 Query: 254 HVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 KSMSSPNFQGPSRAHRTPQEVWC 101 >SB_13902| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 69.7 bits (163), Expect = 2e-12 Identities = 39/84 (46%), Positives = 48/84 (57%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F S+ + RTP ++ C Sbjct: 79 RKSMSSPNFQGSSRAHRTPQEVWC 102 >SB_12205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 69.7 bits (163), Expect = 2e-12 Identities = 39/84 (46%), Positives = 48/84 (57%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + +S EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_7277| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 69.7 bits (163), Expect = 2e-12 Identities = 39/84 (46%), Positives = 48/84 (57%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + +S EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_6814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 69.7 bits (163), Expect = 2e-12 Identities = 39/84 (46%), Positives = 48/84 (57%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F S+ + RTP ++ C Sbjct: 79 RKSMSSPNFQGSSRAHRTPQEVWC 102 >SB_4334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 69.7 bits (163), Expect = 2e-12 Identities = 39/84 (46%), Positives = 48/84 (57%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 10 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 67 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F S+ + RTP ++ C Sbjct: 68 RKSMSSPNFQGSSRAHRTPQEVWC 91 >SB_2347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 69.7 bits (163), Expect = 2e-12 Identities = 39/84 (46%), Positives = 48/84 (57%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F S+ + RTP ++ C Sbjct: 79 RKSMSSPNFQGSSRAHRTPQEVWC 102 >SB_2215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 69.7 bits (163), Expect = 2e-12 Identities = 39/84 (46%), Positives = 48/84 (57%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F S+ + RTP ++ C Sbjct: 79 RKSMSSPNFQGSSRAHRTPQEVWC 102 >SB_1811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 69.7 bits (163), Expect = 2e-12 Identities = 39/84 (46%), Positives = 48/84 (57%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + +S EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_41249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 69.3 bits (162), Expect = 2e-12 Identities = 42/91 (46%), Positives = 50/91 (54%), Gaps = 4/91 (4%) Frame = -1 Query: 446 RPDRA---PGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGI 279 RP RA PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG Sbjct: 14 RPGRASASPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG- 72 Query: 278 WVRTGATSHVHPSREFSRSAESIRTPPQMRC 186 T S F + + RTP ++ C Sbjct: 73 -YEYDRTRKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_35268| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 69.3 bits (162), Expect = 2e-12 Identities = 39/93 (41%), Positives = 50/93 (53%), Gaps = 1/93 (1%) Frame = -1 Query: 461 ITHEHRPDRAPGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCC 285 ++ R +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCC Sbjct: 13 VSTPERASASPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCC 72 Query: 284 GIWVRTGATSHVHPSREFSRSAESIRTPPQMRC 186 G T S F + + RTP ++ C Sbjct: 73 G--YEYDRTRKSMSSPNFQGPSRAHRTPQEVWC 103 >SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 69.3 bits (162), Expect = 2e-12 Identities = 37/73 (50%), Positives = 43/73 (58%) Frame = -1 Query: 404 PDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGATSHVHPSREFSR 225 P + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T S F Sbjct: 84 PRQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRTRKSMSSPNFQG 141 Query: 224 SAESIRTPPQMRC 186 S+ + RTP ++ C Sbjct: 142 SSRAHRTPQEVWC 154 >SB_42078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 68.9 bits (161), Expect = 3e-12 Identities = 39/88 (44%), Positives = 48/88 (54%), Gaps = 1/88 (1%) Frame = -1 Query: 446 RPDRAPGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVR 270 R +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG Sbjct: 18 RASASPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YE 75 Query: 269 TGATSHVHPSREFSRSAESIRTPPQMRC 186 T S F + + RTP ++ C Sbjct: 76 YDRTRKSMSSPNFQGPSRAHRTPQEVWC 103 >SB_26100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 68.9 bits (161), Expect = 3e-12 Identities = 39/88 (44%), Positives = 48/88 (54%), Gaps = 1/88 (1%) Frame = -1 Query: 446 RPDRAPGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVR 270 R +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG Sbjct: 24 RASASPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YE 81 Query: 269 TGATSHVHPSREFSRSAESIRTPPQMRC 186 T S F + + RTP ++ C Sbjct: 82 YDRTRKSMSSPNFQGPSRAHRTPQEVWC 109 >SB_3778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 68.9 bits (161), Expect = 3e-12 Identities = 39/88 (44%), Positives = 48/88 (54%), Gaps = 1/88 (1%) Frame = -1 Query: 446 RPDRAPGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVR 270 R +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG Sbjct: 6 RASASPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YE 63 Query: 269 TGATSHVHPSREFSRSAESIRTPPQMRC 186 T S F + + RTP ++ C Sbjct: 64 YDRTRKSMSSPNFQGPSRAHRTPQEVWC 91 >SB_58070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 68.9 bits (161), Expect = 3e-12 Identities = 39/88 (44%), Positives = 48/88 (54%), Gaps = 1/88 (1%) Frame = -1 Query: 446 RPDRAPGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVR 270 R +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG Sbjct: 89 RASASPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YE 146 Query: 269 TGATSHVHPSREFSRSAESIRTPPQMRC 186 T S F + + RTP ++ C Sbjct: 147 YDRTRKSMSSPNFQGPSRAHRTPQEVWC 174 >SB_50881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 68.9 bits (161), Expect = 3e-12 Identities = 39/88 (44%), Positives = 48/88 (54%), Gaps = 1/88 (1%) Frame = -1 Query: 446 RPDRAPGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVR 270 R +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG Sbjct: 18 RASASPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YE 75 Query: 269 TGATSHVHPSREFSRSAESIRTPPQMRC 186 T S F + + RTP ++ C Sbjct: 76 YDRTRKSMSSPNFQGPSRAHRTPQEVWC 103 >SB_44160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 68.9 bits (161), Expect = 3e-12 Identities = 39/88 (44%), Positives = 48/88 (54%), Gaps = 1/88 (1%) Frame = -1 Query: 446 RPDRAPGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVR 270 R +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG Sbjct: 38 RASASPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YE 95 Query: 269 TGATSHVHPSREFSRSAESIRTPPQMRC 186 T S F + + RTP ++ C Sbjct: 96 YDRTRKSMSSPNFQGPSRAHRTPQEVWC 123 >SB_37446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 68.9 bits (161), Expect = 3e-12 Identities = 39/88 (44%), Positives = 48/88 (54%), Gaps = 1/88 (1%) Frame = -1 Query: 446 RPDRAPGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVR 270 R +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG Sbjct: 24 RASASPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YE 81 Query: 269 TGATSHVHPSREFSRSAESIRTPPQMRC 186 T S F + + RTP ++ C Sbjct: 82 YDRTRKSMSSPNFQGPSRAHRTPQEVWC 109 >SB_12263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 68.9 bits (161), Expect = 3e-12 Identities = 39/88 (44%), Positives = 48/88 (54%), Gaps = 1/88 (1%) Frame = -1 Query: 446 RPDRAPGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVR 270 R +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG Sbjct: 6 RASASPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YE 63 Query: 269 TGATSHVHPSREFSRSAESIRTPPQMRC 186 T S F + + RTP ++ C Sbjct: 64 YDRTRKSMSSPNFQGPSRAHRTPQEVWC 91 >SB_11405| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 68.5 bits (160), Expect = 4e-12 Identities = 38/84 (45%), Positives = 48/84 (57%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYNRTRK 80 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S P+ F + + RTP ++ C Sbjct: 81 SMSSPN--FQGPSRAHRTPQEVWC 102 >SB_5558| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 68.5 bits (160), Expect = 4e-12 Identities = 39/84 (46%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 60 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 117 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F S+ RTP ++ C Sbjct: 118 RKSMSSPNFQGSSRVHRTPQEVWC 141 >SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8) Length = 411 Score = 68.1 bits (159), Expect = 5e-12 Identities = 46/134 (34%), Positives = 64/134 (47%), Gaps = 3/134 (2%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 173 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 230 Query: 257 SHVHPSREFSRSAESIRTPPQMRCSSR--SEPYLPSIGFHGTRTLRQKRKLFPDLSAASS 84 S F S+ + RTP + S+ + ++ F ++T R L P Sbjct: 231 RKSMSSPNFQGSSRAHRTPQEALTSATEVAFTFITPRSFDHSKTRTHVRLLGPCFKTGRM 290 Query: 83 GHFGLPRRTLVFKD 42 + RR + ++ Sbjct: 291 RPYDRQRRGCIVRN 304 >SB_59787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 10 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 67 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 68 RKSMSSPNFQGPSRAHRTPQEVWC 91 >SB_59379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_59234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_58491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_57948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 10 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 67 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 68 RKSMSSPNFQGPSRAHRTPQEVWC 91 >SB_56753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_53500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 59 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 116 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 117 RKSMSSPNFQGPSRAHRTPQEVWC 140 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 67.7 bits (158), Expect = 7e-12 Identities = 33/51 (64%), Positives = 36/51 (70%), Gaps = 1/51 (1%) Frame = -3 Query: 432 TGPHPLPVQTRHA-PVLRANPYSEVTDPICRLPLPTLFYRLEALHLGDLLR 283 +GP PL P LRANP+ EVTD CRLPLPTLFY+ EA HLGDLLR Sbjct: 23 SGPGPLASSLSPTDPTLRANPFPEVTDLFCRLPLPTLFYQPEAAHLGDLLR 73 >SB_53114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_52245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_51644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 10 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 67 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 68 RKSMSSPNFQGPSRAHRTPQEVWC 91 >SB_51062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_48392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_46317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 10 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 67 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 68 RKSMSSPNFQGPSRAHRTPQEVWC 91 >SB_46056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_46043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_44153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 94 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 151 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 152 RKSMSSPNFQGPSRAHRTPQEVWC 175 >SB_44051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_43906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 10 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 67 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 68 RKSMSSPNFQGPSRAHRTPQEVWC 91 >SB_42917| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_41356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_40472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_39541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_39300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_38833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_37911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_37424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_37302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_37110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 94 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 151 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 152 RKSMSSPNFQGPSRAHRTPQEVWC 175 >SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 94 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 151 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 152 RKSMSSPNFQGPSRAHRTPQEVWC 175 >SB_33667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 10 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 67 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 68 RKSMSSPNFQGPSRAHRTPQEVWC 91 >SB_33364| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_31814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_30660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_30006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 10 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 67 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 68 RKSMSSPNFQGPSRAHRTPQEVWC 91 >SB_29366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_27748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 10 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 67 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 68 RKSMSSPNFQGPSRAHRTPQEVWC 91 >SB_27084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_27021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_26273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_26010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_25546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 22 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 79 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 80 RKSMSSPNFQGPSRAHRTPQEVWC 103 >SB_24341| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_23921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_19588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_19288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_18833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_18210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_18149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 22 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 79 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 80 RKSMSSPNFQGPSRAHRTPQEVWC 103 >SB_17336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 10 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 67 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 68 RKSMSSPNFQGPSRAHRTPQEVWC 91 >SB_15920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 248 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 163 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 220 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 221 RKSMSSPNFQGPSRAHRTPQEVWC 244 >SB_15538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 10 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 67 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 68 RKSMSSPNFQGPSRAHRTPQEVWC 91 >SB_14422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_13971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_12408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_12224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_11305| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_11121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 31 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 88 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 89 RKSMSSPNFQGPSRAHRTPQEVWC 112 >SB_7698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 59 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 116 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 117 RKSMSSPNFQGPSRAHRTPQEVWC 140 >SB_6536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_4627| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_4362| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPFEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVCC 102 >SB_550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_527| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 218 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 133 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 190 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 191 RKSMSSPNFQGPSRAHRTPQEVWC 214 >SB_59314| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 94 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 151 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 152 RKSMSSPNFQGPSRAHRTPQEVWC 175 >SB_58870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_58253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_57993| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_54803| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_53700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_53306| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 10 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 67 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 68 RKSMSSPNFQGPSRAHRTPQEVWC 91 >SB_53021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_52780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 10 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 67 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 68 RKSMSSPNFQGPSRAHRTPQEVWC 91 >SB_51768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 10 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 67 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 68 RKSMSSPNFQGPSRAHRTPQEVWC 91 >SB_51582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 10 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 67 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 68 RKSMSSPNFQGPSRAHRTPQEVWC 91 >SB_51426| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 94 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 151 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 152 RKSMSSPNFQGPSRAHRTPQEVWC 175 >SB_50985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_50975| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 10 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 67 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 68 RKSMSSPNFQGPSRAHRTPQEVWC 91 >SB_49521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 10 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 67 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 68 RKSMSSPNFQGPSRAHRTPQEVWC 91 >SB_49109| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_47871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 10 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 67 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 68 RKSMSSPNFQGPSRAHRTPQEVWC 91 >SB_45833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_45139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_44724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_42353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_42008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 10 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 67 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 68 RKSMSSPNFQGPSRAHRTPQEVWC 91 >SB_41961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_41130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 10 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 67 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 68 RKSMSSPNFQGPSRAHRTPQEVWC 91 >SB_40711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 10 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 67 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 68 RKSMSSPNFQGPSRAHRTPQEVWC 91 >SB_40110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 217 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 132 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 189 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 190 RKSMSSPNFQGPSRAHRTPQEVWC 213 >SB_39752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 10 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 67 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 68 RKSMSSPNFQGPSRAHRTPQEVWC 91 >SB_39077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_37191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_36226| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 10 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 67 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 68 RKSMSSPNFQGPSRAHRTPQEVWC 91 >SB_34914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_34567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_34080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 10 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 67 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 68 RKSMSSPNFQGPSRAHRTPQEVWC 91 >SB_33471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 10 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 67 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 68 RKSMSSPNFQGPSRAHRTPQEVWC 91 >SB_31864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 10 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 67 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 68 RKSMSSPNFQGPSRAHRTPQEVWC 91 >SB_29675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_28321| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_27775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_27330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 10 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 67 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 68 RKSMSSPNFQGPSRAHRTPQEVWC 91 >SB_26901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 10 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 67 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 68 RKSMSSPNFQGPSRAHRTPQEVWC 91 >SB_26760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_26472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_26164| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_25733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_24943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_22336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 10 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 67 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 68 RKSMSSPNFQGPSRAHRTPQEVWC 91 >SB_22065| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 217 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 132 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 189 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 190 RKSMSSPNFQGPSRAHRTPQEVWC 213 >SB_21160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 10 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 67 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 68 RKSMSSPNFQGPSRAHRTPQEVWC 91 >SB_20762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 10 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 67 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 68 RKSMSSPNFQGPSRAHRTPQEVWC 91 >SB_19810| Best HMM Match : Cathelicidins (HMM E-Value=4.8) Length = 204 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 119 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 176 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 177 RKSMSSPNFQGPSRAHRTPQEVWC 200 >SB_19474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_19236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_19110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 10 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 67 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 68 RKSMSSPNFQGPSRAHRTPQEVWC 91 >SB_19089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 59 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 116 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 117 RKSMSSPNFQGPSRAHRTPQEVWC 140 >SB_18734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 10 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 67 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 68 RKSMSSPNFQGPSRAHRTPQEVWC 91 >SB_18260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_17829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_17440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 10 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 67 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 68 RKSMSSPNFQGPSRAHRTPQEVWC 91 >SB_16931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_14957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_14440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 10 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 67 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 68 RKSMSSPNFQGPSRAHRTPQEVWC 91 >SB_14017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_11334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_10849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_6271| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_5929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_5657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_5275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_4697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSTRQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_4589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_4504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 60 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 117 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 118 RKSMSSPNFQGPSRAHRTPQEVWC 141 >SB_4388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 59 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 116 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 117 RKSMSSPNFQGPSRAHRTPQEVWC 140 >SB_3842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 10 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 67 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 68 RKSMSSPNFQGPSRAHRTPQEVWC 91 >SB_3072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_2183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_2030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_1600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_1514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.7 bits (158), Expect = 7e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_25780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 67.3 bits (157), Expect = 9e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + +S EPIL KLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARRTQSKEPILFSKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_15901| Best HMM Match : Defensin_1 (HMM E-Value=8.6) Length = 106 Score = 67.3 bits (157), Expect = 9e-12 Identities = 38/84 (45%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLHTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_29170| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 67.3 bits (157), Expect = 9e-12 Identities = 37/78 (47%), Positives = 45/78 (57%), Gaps = 1/78 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRK 80 Query: 257 SHVHPSREFSRSAESIRT 204 S P+ EF + S R+ Sbjct: 81 SMSSPNIEFLQPGGSTRS 98 >SB_29105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 67.3 bits (157), Expect = 9e-12 Identities = 39/75 (52%), Positives = 44/75 (58%), Gaps = 1/75 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRK 80 Query: 257 SHVHPSREFSRSAES 213 S P EFSR ES Sbjct: 81 SMSFP--EFSRVVES 93 >SB_10006| Best HMM Match : 7tm_1 (HMM E-Value=0.0022) Length = 309 Score = 67.3 bits (157), Expect = 9e-12 Identities = 38/82 (46%), Positives = 47/82 (57%), Gaps = 1/82 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + +S EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQM 192 S F + + RTP ++ Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEV 100 >SB_48030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 66.9 bits (156), Expect = 1e-11 Identities = 35/66 (53%), Positives = 40/66 (60%) Frame = -1 Query: 383 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGATSHVHPSREFSRSAESIRT 204 EPIL PKLRI FADFPYLH SI+ RL TLETCCG T S F + + RT Sbjct: 77 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRTRKSMSSPNFQGPSRAHRT 134 Query: 203 PPQMRC 186 P ++ C Sbjct: 135 PQEVWC 140 >SB_46148| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 66.9 bits (156), Expect = 1e-11 Identities = 35/66 (53%), Positives = 40/66 (60%) Frame = -1 Query: 383 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGATSHVHPSREFSRSAESIRT 204 EPIL PKLRI FADFPYLH SI+ RL TLETCCG T S F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRTRKSMSSPNFQGPSRAHRT 96 Query: 203 PPQMRC 186 P ++ C Sbjct: 97 PQEVWC 102 >SB_39402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 66.9 bits (156), Expect = 1e-11 Identities = 35/66 (53%), Positives = 40/66 (60%) Frame = -1 Query: 383 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGATSHVHPSREFSRSAESIRT 204 EPIL PKLRI FADFPYLH SI+ RL TLETCCG T S F + + RT Sbjct: 34 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRTRKSMSSPNFQGPSRAHRT 91 Query: 203 PPQMRC 186 P ++ C Sbjct: 92 PQEVWC 97 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 66.9 bits (156), Expect = 1e-11 Identities = 38/81 (46%), Positives = 46/81 (56%), Gaps = 1/81 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQ 195 S F S+ + RTP + Sbjct: 79 RKSMSSPNFQGSSRAHRTPQE 99 >SB_25677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 66.9 bits (156), Expect = 1e-11 Identities = 35/66 (53%), Positives = 40/66 (60%) Frame = -1 Query: 383 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGATSHVHPSREFSRSAESIRT 204 EPIL PKLRI FADFPYLH SI+ RL TLETCCG T S F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRTRKSMSSPNFQGPSRAHRT 96 Query: 203 PPQMRC 186 P ++ C Sbjct: 97 PQEVWC 102 >SB_16953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 66.9 bits (156), Expect = 1e-11 Identities = 35/66 (53%), Positives = 40/66 (60%) Frame = -1 Query: 383 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGATSHVHPSREFSRSAESIRT 204 EPIL PKLRI FADFPYLH SI+ RL TLETCCG T S F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRTRKSMSSPNFQGPSRAHRT 85 Query: 203 PPQMRC 186 P ++ C Sbjct: 86 PQEVWC 91 >SB_14500| Best HMM Match : Vicilin_N (HMM E-Value=5.3) Length = 237 Score = 66.5 bits (155), Expect = 2e-11 Identities = 40/91 (43%), Positives = 49/91 (53%), Gaps = 1/91 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRCSSRSEPY 165 S F + + RTP + + R PY Sbjct: 79 RKSMSSPNFQGPSRAHRTPQE---TGRMRPY 106 >SB_2991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 66.5 bits (155), Expect = 2e-11 Identities = 37/84 (44%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH +I+ RL TLETCCG T Sbjct: 34 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCAINQRLLTLETCCG--YEYDRT 91 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 92 RKSMSSPNFQGPSRAHRTPQEVWC 115 >SB_55151| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 402 Score = 66.1 bits (154), Expect = 2e-11 Identities = 45/134 (33%), Positives = 63/134 (47%), Gaps = 3/134 (2%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 160 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 217 Query: 257 SHVHPSREFSRSAESIRTPPQMRCSSR--SEPYLPSIGFHGTRTLRQKRKLFPDLSAASS 84 S F + + RTP + S+ + ++ F ++T R L P Sbjct: 218 RKSMSSPNFQGPSRAHRTPQEALTSATEVAFTFISPRSFDHSKTRTHVRLLGPCFKTGRM 277 Query: 83 GHFGLPRRTLVFKD 42 + RR + ++ Sbjct: 278 RPYDRQRRGCIVRN 291 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 66.1 bits (154), Expect = 2e-11 Identities = 38/83 (45%), Positives = 46/83 (55%), Gaps = 1/83 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 59 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 116 Query: 257 SHVHPSREFSRSAESIRTPPQMR 189 S F + + RTP + R Sbjct: 117 RKSMSSPNFQGPSRAHRTPQENR 139 >SB_5999| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 66.1 bits (154), Expect = 2e-11 Identities = 37/84 (44%), Positives = 46/84 (54%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI F DFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFVDFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 65.7 bits (153), Expect = 3e-11 Identities = 35/65 (53%), Positives = 40/65 (61%) Frame = -1 Query: 383 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGATSHVHPSREFSRSAESIRT 204 EPIL+PKLRI FADFPYLH SI+ RL TLETCCG T S F + + RT Sbjct: 28 EPILLPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRTRKSMSSPNFQGPSRAHRT 85 Query: 203 PPQMR 189 P + R Sbjct: 86 PQEDR 90 >SB_57544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 65.3 bits (152), Expect = 4e-11 Identities = 37/84 (44%), Positives = 46/84 (54%), Gaps = 1/84 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL LETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLKLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 79 RKSMSSPNFQGPSRAHRTPQEVWC 102 >SB_46002| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 64.9 bits (151), Expect = 5e-11 Identities = 37/81 (45%), Positives = 45/81 (55%), Gaps = 1/81 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQ 195 S F + + RTP + Sbjct: 79 RKSMSSPNFQGPSRAHRTPQE 99 >SB_5290| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 64.9 bits (151), Expect = 5e-11 Identities = 31/52 (59%), Positives = 36/52 (69%), Gaps = 1/52 (1%) Frame = -1 Query: 434 APGRIRFPSKPDTPRSS-EPILIPKLRIQFADFPYLHYSID*RLFTLETCCG 282 +PGR+ + S +PIL PKLRI FADFPYLH SI+ RL TLETCCG Sbjct: 21 SPGRVHWLQVSSRQTQSLDPILFPKLRIYFADFPYLHCSINQRLLTLETCCG 72 >SB_41530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 261 Score = 64.9 bits (151), Expect = 5e-11 Identities = 37/81 (45%), Positives = 45/81 (55%), Gaps = 1/81 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTPPQ 195 S F + + RTP + Sbjct: 79 RKSMSSPNFQGPSRAHRTPQE 99 >SB_23689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 64.5 bits (150), Expect = 6e-11 Identities = 34/64 (53%), Positives = 39/64 (60%) Frame = -1 Query: 383 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGATSHVHPSREFSRSAESIRT 204 EPIL PKLRI FADFPYLH SI+ RL TLETCCG T S F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRTRKSMSSPNFQGPSRAHRT 85 Query: 203 PPQM 192 P ++ Sbjct: 86 PQEV 89 >SB_48541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 64.1 bits (149), Expect = 8e-11 Identities = 31/52 (59%), Positives = 36/52 (69%), Gaps = 1/52 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCG 282 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG 72 >SB_12204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 64.1 bits (149), Expect = 8e-11 Identities = 31/52 (59%), Positives = 36/52 (69%), Gaps = 1/52 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCG 282 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG 72 >SB_55223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 64.1 bits (149), Expect = 8e-11 Identities = 31/52 (59%), Positives = 36/52 (69%), Gaps = 1/52 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCG 282 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG 72 Score = 27.5 bits (58), Expect = 8.9 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -2 Query: 277 GYEPARHLTYIPHVNFQGPQRVSGHRRKC 191 GYE R + NFQG + +GH +KC Sbjct: 72 GYEYDRTRKSMSSPNFQGRRERTGHHKKC 100 >SB_25347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 64.1 bits (149), Expect = 8e-11 Identities = 31/52 (59%), Positives = 36/52 (69%), Gaps = 1/52 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCG 282 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG 72 Score = 27.9 bits (59), Expect = 6.7 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = -2 Query: 277 GYEPARHLTY-IPHVNFQGPQRVSGHRRKCGAL 182 GYE H +P + F+G + +GH +KCGAL Sbjct: 72 GYEYDGHENQCLPRI-FKGRRERTGHHKKCGAL 103 >SB_17175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 64.1 bits (149), Expect = 8e-11 Identities = 31/52 (59%), Positives = 36/52 (69%), Gaps = 1/52 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCG 282 +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCG Sbjct: 21 SPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG 72 >SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) Length = 782 Score = 63.3 bits (147), Expect = 1e-10 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -1 Query: 383 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCG 282 EPIL PKLRI FADFPYLH SI+ RL TLETCCG Sbjct: 734 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCG 767 >SB_29399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 63.3 bits (147), Expect = 1e-10 Identities = 37/79 (46%), Positives = 44/79 (55%), Gaps = 1/79 (1%) Frame = -1 Query: 434 APGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGAT 258 +PGR+ + +S EPIL KLRI FADFPYLH SI+ RL TLETCCG T Sbjct: 21 SPGRVHWLQVSARRTQSLEPILFSKLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRT 78 Query: 257 SHVHPSREFSRSAESIRTP 201 S F + + RTP Sbjct: 79 RKSMSSPNFQGPSRAHRTP 97 >SB_38201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 56.0 bits (129), Expect = 2e-08 Identities = 32/77 (41%), Positives = 41/77 (53%) Frame = -1 Query: 416 FPSKPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGATSHVHPSR 237 F ++ P + P +LRI FADFPYLH SI+ RL TLETCCG T S Sbjct: 1 FSARQTQPLEANPFS-RRLRIYFADFPYLHCSINQRLLTLETCCG--YEYDRTRKSMSSP 57 Query: 236 EFSRSAESIRTPPQMRC 186 F + + RTP ++ C Sbjct: 58 NFQGPSRAHRTPQEVWC 74 >SB_37577| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 54.0 bits (124), Expect = 9e-08 Identities = 29/59 (49%), Positives = 34/59 (57%) Frame = -1 Query: 362 LRIQFADFPYLHYSID*RLFTLETCCGIWVRTGATSHVHPSREFSRSAESIRTPPQMRC 186 LRI FADFPYLH SI+ RL TLETCCG T S F + + RTP ++ C Sbjct: 1 LRIYFADFPYLHCSINQRLLTLETCCG--YEYDRTRKSMSSPNFQGPSRAHRTPQEVWC 57 >SB_9828| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 54.0 bits (124), Expect = 9e-08 Identities = 29/59 (49%), Positives = 34/59 (57%) Frame = -1 Query: 362 LRIQFADFPYLHYSID*RLFTLETCCGIWVRTGATSHVHPSREFSRSAESIRTPPQMRC 186 LRI FADFPYLH SI+ RL TLETCCG T S F + + RTP ++ C Sbjct: 1 LRIYFADFPYLHCSINQRLLTLETCCG--YEYDRTRKSMSSPNFQGPSRAHRTPQEVWC 57 >SB_54766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 54.0 bits (124), Expect = 9e-08 Identities = 29/59 (49%), Positives = 34/59 (57%) Frame = -1 Query: 362 LRIQFADFPYLHYSID*RLFTLETCCGIWVRTGATSHVHPSREFSRSAESIRTPPQMRC 186 LRI FADFPYLH SI+ RL TLETCCG T S F + + RTP ++ C Sbjct: 2 LRIYFADFPYLHCSINQRLLTLETCCG--YEYDRTRKSMSSPNFQGPSRAHRTPQEVWC 58 >SB_46053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 54.0 bits (124), Expect = 9e-08 Identities = 29/59 (49%), Positives = 34/59 (57%) Frame = -1 Query: 362 LRIQFADFPYLHYSID*RLFTLETCCGIWVRTGATSHVHPSREFSRSAESIRTPPQMRC 186 LRI FADFPYLH SI+ RL TLETCCG T S F + + RTP ++ C Sbjct: 1 LRIYFADFPYLHCSINQRLLTLETCCG--YEYDRTRKSMSSPNFQGPSRAHRTPQEVWC 57 >SB_34291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 50.8 bits (116), Expect = 8e-07 Identities = 22/27 (81%), Positives = 23/27 (85%) Frame = -1 Query: 362 LRIQFADFPYLHYSID*RLFTLETCCG 282 LRI FADFPYLH SI+ RL TLETCCG Sbjct: 1 LRIYFADFPYLHVSINQRLLTLETCCG 27 >SB_15129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 50.8 bits (116), Expect = 8e-07 Identities = 27/57 (47%), Positives = 32/57 (56%) Frame = -1 Query: 356 IQFADFPYLHYSID*RLFTLETCCGIWVRTGATSHVHPSREFSRSAESIRTPPQMRC 186 I FADFPYLH SI+ RL TLETCCG T S F + + RTP ++ C Sbjct: 4 IYFADFPYLHVSINQRLLTLETCCG--YEYDRTRKSMSSPNFQGPSRAHRTPQEVWC 58 >SB_1430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 50.8 bits (116), Expect = 8e-07 Identities = 32/83 (38%), Positives = 41/83 (49%), Gaps = 1/83 (1%) Frame = -1 Query: 431 PGRIRFPSKPDTPR-SSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGATS 255 PG + P P + P P++ FADFPYLH SI+ RL TLETCCG T Sbjct: 25 PGPLASSLSPTDPTLRANPF--PEVTDLFADFPYLHCSINQRLLTLETCCG--YEYDRTR 80 Query: 254 HVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 81 KSMSSPNFQGPSRAHRTPQEVWC 103 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 50.8 bits (116), Expect = 8e-07 Identities = 28/56 (50%), Positives = 34/56 (60%), Gaps = 3/56 (5%) Frame = -1 Query: 443 PDRAPGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLF--TLETCC 285 P +PGR+ + + EPIL PKLRI FADFPYLH SI+ RL LE+ C Sbjct: 31 PSASPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLGDPLESTC 86 >SB_5943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 50.4 bits (115), Expect = 1e-06 Identities = 27/57 (47%), Positives = 32/57 (56%) Frame = -1 Query: 356 IQFADFPYLHYSID*RLFTLETCCGIWVRTGATSHVHPSREFSRSAESIRTPPQMRC 186 I FADFPYLH SI+ RL TLETCCG T S F + + RTP ++ C Sbjct: 10 IYFADFPYLHCSINQRLLTLETCCG--YEYDRTRKSMSSPNFQGPSRAHRTPQEVWC 64 >SB_49932| Best HMM Match : DUF1518 (HMM E-Value=4.9) Length = 276 Score = 41.5 bits (93), Expect = 5e-04 Identities = 29/86 (33%), Positives = 38/86 (44%), Gaps = 1/86 (1%) Frame = -1 Query: 431 PGRIRFPSKPDTPR-SSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGATS 255 PG + P P + P P++ F PYLH SI+ RL TLETCCG T Sbjct: 129 PGPLASSLSPTDPTLRANPF--PEVTDLFCRLPYLHCSINQRLLTLETCCG--YEYDRTR 184 Query: 254 HVHPSREFSRSAESIRTPPQMRCSSR 177 S F + + RTP ++ R Sbjct: 185 KSMSSPNFQGPSRAHRTPQEICTGGR 210 >SB_44744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 40.3 bits (90), Expect = 0.001 Identities = 28/83 (33%), Positives = 37/83 (44%), Gaps = 1/83 (1%) Frame = -1 Query: 431 PGRIRFPSKPDTPR-SSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGIWVRTGATS 255 PG + P P + P P++ F P LH SI+ RL TLETCCG T Sbjct: 25 PGPLASSLSPTDPTLRANPF--PEVTDLFCRLPLLHCSINQRLLTLETCCG--YEYDRTR 80 Query: 254 HVHPSREFSRSAESIRTPPQMRC 186 S F + + RTP ++ C Sbjct: 81 KSMSSPNFQGPSRAHRTPQEVWC 103 Score = 38.7 bits (86), Expect = 0.004 Identities = 19/34 (55%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -3 Query: 432 TGPHPLPVQTRHA-PVLRANPYSEVTDPICRLPL 334 +GP PL P LRANP+ EVTD CRLPL Sbjct: 23 SGPGPLASSLSPTDPTLRANPFPEVTDLFCRLPL 56 >SB_41893| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 37.9 bits (84), Expect = 0.006 Identities = 29/81 (35%), Positives = 43/81 (53%), Gaps = 4/81 (4%) Frame = -2 Query: 247 IPHVNFQGPQRVSGHRRKCGALRVPNHISLL*DSMELERSG--RKENSSRTSRRRLQATL 74 +P + F+G + +GH +KCGAL P+ L S S RKENSS+ R+RL+ L Sbjct: 11 LPRI-FKGRRERTGHHKKCGAL--PSIKPYLQASRFQGESSLKRKENSSQGPRQRLRVRL 67 Query: 73 GYPV--EHSFLKTRERLLKRF 17 Y + E + + +L RF Sbjct: 68 RYRICRERQYPRPGSGILTRF 88 >SB_23757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2834 Score = 36.7 bits (81), Expect = 0.015 Identities = 25/93 (26%), Positives = 38/93 (40%) Frame = -3 Query: 516 PPSSGRIILKYLTSLKTKHNARTSTRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICRLP 337 P + R I T++ T+H A T T P H P T P + +P S +T P+ P Sbjct: 1174 PAVTQRPITTMSTTVVTQHPASTITTPAVTQH--PASTITTPAVTQHPASTITVPVVTQP 1231 Query: 336 LPTLFYRLEALHLGDLLRNMGTNRRDISRTSLT 238 T F + L+ M N + + +T Sbjct: 1232 EVTTFTEVAVTKQPALVATMPVNTQAVVANMVT 1264 >SB_18142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 35.5 bits (78), Expect = 0.034 Identities = 22/45 (48%), Positives = 27/45 (60%), Gaps = 3/45 (6%) Frame = -1 Query: 311 RLFTLETCCGI---WVRTGATSHVHPSREFSRSAESIRTPPQMRC 186 RLFTLETCCG WVR + PS +F S+E+ RT +M C Sbjct: 1 RLFTLETCCGYEYGWVRESFS----PS-DFHGSSEAHRTQQKMSC 40 >SB_27417| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) Length = 538 Score = 33.1 bits (72), Expect = 0.18 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = -2 Query: 277 GYEPARHLTYIPHVNFQGPQRVSGHRRKCGAL 182 GYE R + NFQG + +GH +KCGAL Sbjct: 116 GYEYDRTRKSMSSPNFQGRRERTGHHKKCGAL 147 >SB_12021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 51 Score = 33.1 bits (72), Expect = 0.18 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = -2 Query: 277 GYEPARHLTYIPHVNFQGPQRVSGHRRKCGAL 182 GYE R + NFQG + +GH +KCGAL Sbjct: 10 GYEYDRTRKSMSSPNFQGRRERTGHHKKCGAL 41 >SB_22731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 32.3 bits (70), Expect = 0.31 Identities = 22/53 (41%), Positives = 26/53 (49%), Gaps = 2/53 (3%) Frame = -1 Query: 311 RLFTLETCCGIWVRTGATSHVHPSREFSRSAESIRTPPQMRCSS--RSEPYLP 159 RL TLETCCG S P EFSR+ RT +C + +PYLP Sbjct: 1 RLLTLETCCGYEYDRTRKSMSFP--EFSRAVRE-RTGHHKKCGALPSIKPYLP 50 >SB_57695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 51 Score = 31.5 bits (68), Expect = 0.55 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = -2 Query: 277 GYEPARHLTYIPHVNFQGPQRVSGHRRKCGAL 182 GYE R + NF+G + +GH +KCGAL Sbjct: 10 GYEYDRTRKSMSSPNFKGRRERTGHHKKCGAL 41 >SB_33090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 30.7 bits (66), Expect = 0.96 Identities = 17/42 (40%), Positives = 21/42 (50%) Frame = -1 Query: 311 RLFTLETCCGIWVRTGATSHVHPSREFSRSAESIRTPPQMRC 186 RL TLETCCG T S F S+ + RTP ++ C Sbjct: 40 RLLTLETCCG--YEYDRTRKSMSSPNFQGSSRAHRTPQEVWC 79 >SB_21833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 30.7 bits (66), Expect = 0.96 Identities = 17/42 (40%), Positives = 21/42 (50%) Frame = -1 Query: 311 RLFTLETCCGIWVRTGATSHVHPSREFSRSAESIRTPPQMRC 186 RL TLETCCG T S F S+ + RTP ++ C Sbjct: 40 RLLTLETCCG--YEYDRTRKSMSSPNFQGSSRAHRTPQEVWC 79 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,332,491 Number of Sequences: 59808 Number of extensions: 487545 Number of successful extensions: 5347 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4446 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4652 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1475788250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -