BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0090 (605 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 23 1.8 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 23 3.1 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 23 3.1 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 23 3.1 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 23 3.1 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 3.1 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 22 4.1 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 22 5.4 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 21 9.4 DQ435336-1|ABD92651.1| 135|Apis mellifera OBP19 protein. 21 9.4 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 21 9.4 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 23.4 bits (48), Expect = 1.8 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 441 RPGTGPHPLPVQTRHAPVLRANPYSEV 361 + G P PLP A + + +PYS + Sbjct: 647 KDGQSPFPLPPNLASANISQLDPYSSL 673 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.6 bits (46), Expect = 3.1 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = -1 Query: 452 EHRPDRAPGRIRFPSKPDTPRSSEPILIPKLRIQFADFPYLHYS 321 E+R R R R + + RS EP +I L + Y +Y+ Sbjct: 55 EYREYRETSRERSRDRKERERSKEPKIISSLSNNYKYSNYNNYN 98 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.6 bits (46), Expect = 3.1 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = -1 Query: 452 EHRPDRAPGRIRFPSKPDTPRSSEPILIPKLRIQFADFPYLHYS 321 E+R R R R + + RS EP +I L + Y +Y+ Sbjct: 55 EYREYRETSRERSRDRKERERSKEPKIISSLSNNYKYSNYNNYN 98 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.6 bits (46), Expect = 3.1 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = -1 Query: 452 EHRPDRAPGRIRFPSKPDTPRSSEPILIPKLRIQFADFPYLHYS 321 E+R R R R + + RS EP +I L + Y +Y+ Sbjct: 55 EYREYRETSRERSRDRKERERSKEPKIISSLSNNYKYSNYNNYN 98 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.6 bits (46), Expect = 3.1 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = -1 Query: 452 EHRPDRAPGRIRFPSKPDTPRSSEPILIPKLRIQFADFPYLHYS 321 E+R R R R + + RS EP +I L + Y +Y+ Sbjct: 55 EYREYRETSRERSRDRKERERSKEPKIISSLSNNYKYSNYNNYN 98 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.6 bits (46), Expect = 3.1 Identities = 7/26 (26%), Positives = 14/26 (53%) Frame = -1 Query: 278 WVRTGATSHVHPSREFSRSAESIRTP 201 W+ G T + + S+ +++RTP Sbjct: 516 WIERGTTKSMEAANIMSKLPKTVRTP 541 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 22.2 bits (45), Expect = 4.1 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -1 Query: 107 PDLSAASSGHFGLPRRTLVFK 45 PDL+ S G GLP L + Sbjct: 336 PDLAGTSQGSAGLPSAILAMR 356 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 21.8 bits (44), Expect = 5.4 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = -1 Query: 176 SEPYLPSIGFHGTRTLRQKRKLFPDLSA 93 SE P+ HG R RQ+ + D + Sbjct: 472 SENNYPTTSIHGDRLQRQREEALADFKS 499 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 21.0 bits (42), Expect = 9.4 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -3 Query: 153 RIPWNSNAQAEKKTLPGPLG 94 +IPW+ N +A K G G Sbjct: 334 QIPWDKNVEALAKWANGQTG 353 >DQ435336-1|ABD92651.1| 135|Apis mellifera OBP19 protein. Length = 135 Score = 21.0 bits (42), Expect = 9.4 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +2 Query: 203 VSGYSLRTLKIHVRDVREM 259 V+ ++ LKI +RDV+E+ Sbjct: 14 VNAMTIEELKIQLRDVQEI 32 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 21.0 bits (42), Expect = 9.4 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +2 Query: 62 DGVTQSGLKTPPRGPG 109 DG L +PPR PG Sbjct: 128 DGPPSVSLSSPPREPG 143 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,420 Number of Sequences: 438 Number of extensions: 4648 Number of successful extensions: 21 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17848938 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -