BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0089 (426 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g12850.1 68416.m01602 COP9 signalosome complex-related / CSN ... 27 5.3 At1g63020.1 68414.m07117 DNA-directed RNA polymerase alpha subun... 27 7.0 >At3g12850.1 68416.m01602 COP9 signalosome complex-related / CSN complex-related low similarity to SP|P45432 COP9 signalosome complex subunit 1 (CSN complex subunit 1) (COP11 protein) (FUSCA protein FUS6) {Arabidopsis thaliana} Length = 367 Score = 27.1 bits (57), Expect = 5.3 Identities = 21/59 (35%), Positives = 28/59 (47%) Frame = -1 Query: 426 QSVDIFYIFLLHAMNVAIRRLIGFMSIASLRDENKFYCNYNYFYGLKLRFFIKLSLLLE 250 Q++D + LL A+ R G + S+ E YCN YG K+ F LS LLE Sbjct: 147 QTIDAYMATLLVALET---RNFGELPHRSV--EQIAYCNVKRAYGFKIDCFKSLSNLLE 200 >At1g63020.1 68414.m07117 DNA-directed RNA polymerase alpha subunit family protein low similarity to RNA polymerase IIA largest subunit [Trypanosoma brucei] GI:162215; contains InterPro accession IPR000722: RNA polymerase, alpha subunit Length = 1453 Score = 26.6 bits (56), Expect = 7.0 Identities = 23/77 (29%), Positives = 36/77 (46%), Gaps = 2/77 (2%) Frame = +1 Query: 19 VLHATFLQHYRRAI*SLEFGKNIMTKKLILQLFKWSKLN*LKTS--NC*C*YQIKRTLNY 192 +LH+ FL+ + + GK I L+ +F W + L S Y+I LN Sbjct: 1308 LLHSAFLKDIK-----VLDGKGI-PMSLLRTIFTWKNIELLSQSLKRILHSYEINELLNE 1361 Query: 193 KDKCRVLSVISLKPNSL 243 +D+ V V+ L PNS+ Sbjct: 1362 RDEGLVKMVLQLHPNSV 1378 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,785,648 Number of Sequences: 28952 Number of extensions: 120747 Number of successful extensions: 212 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 212 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 212 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 665183504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -